Illuminati Subcontract Factory Samsung Electronics Devil Chairman Lee Jae-yong Satan Lucifer The reason why the dates of human sacrifice are expressed as decimals such as 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, etc. 일루미나티 하청공장 삼성전자 악마 회장 이재용 사탄 루시퍼 인신공양 날짜를 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37 등 소수로 표현하는 이유

Illuminati Subcontract Factory Samsung Electronics Devil Chairman Lee Jae-yong Satan Lucifer The reason why the dates of human sacrifice are expressed as decimals such as 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37, etc.

일루미나티 하청공장 삼성전자 악마 회장 이재용 사탄 루시퍼 인신공양 날짜를 3, 5, 7, 11, 13, 17, 19, 23, 29, 31, 37 등 소수로 표현하는 이유


Satan Lucifer, who controls the matter of the universe, is the dark matter of the universe. 

 It can be said that it controls mass and gravity, interacts with matter, and creates the ‘differentiation of matter’ that forms the structure of the universe.

우주의 물질을 주관하는 사탄 루시퍼는 우주의 암흑물질이다. 

 질량과 중력을 제어하고, 물질과 상호작용하며, 우주의 구조를 이루는 '물질의 분화'를 만들어낸다고 할 수 있다.



Shakyamuni believed that human greed and obsession caused suffering. Greed for money or material things, obsession with people or things, etc. make us anxious and dissatisfied and cause pain.

석가모니는 인간의 탐욕과 집착이 고통을 가져온다고 믿었습니다. 돈이나 물질에 대한 탐욕, 사람이나 사물에 대한 집착 등은 우리를 불안하게 하고 불만족하게 하며 고통을 줍니다.


The Avatamsaka Sutra represents the truth of dependent origination (緣起) in which all phenomena in the material world are interdependent and interpenetrating, and liberation in Buddhism means the state of enlightenment beyond attachment and discrimination to the material world, that is, freeing oneself from suffering by fully experiencing the truth of dependent origination. This can be understood as the process of escaping from the world of desires, instincts, and unconsciousness of the material world and moving toward the spiritual world of enlightenment.





화엄경은 물질계의 모든 현상이 상호 의존하고 상호 침투하는 연기(緣起)의 진리를 나타내며, 불교에서의 해탈은 물질계에 대한 집착과 차별을 초월한 깨달음, 즉 연기의 진리를 충분히 경험하여 괴로움에서 벗어나는 상태를 의미합니다. 이는 물질계의 욕망, 본능, 무의식의 세계에서 벗어나 깨달음의 정신세계를 향해 나아가는 과정으로 이해될 수 있다.


The core idea of ​​the Avatamsaka Sutra, **Environment of the Dharma Realm**, explains that the material world in which humans and animals live, ruled by the dark matter of Satan and Lucifer, is where all beings are dependent and connected to each other, and that material discrimination and obsession are at the root of it. Escaping from the material world and escaping from material discrimination and obsession to a spiritual dimension without discrimination leads to Buddhist liberation.


화엄경의 핵심 사상인 **법계의 환경**은 인간과 동물이 살고 있는 물질계, 즉 사탄과 루시퍼의 암흑물질이 지배하는 물질계는 모든 존재가 서로 의존하고 연결되어 있는 곳이며, 그 근원에는 물질적 차별과 집착이 있음을 설명하고 있다. 물질계에서 벗어나 물질적 차별과 집착에서 벗어나 차별 없는 정신적 차원으로 나아가는 것이 불교의 해방으로 이어진다.



 Buddhism's 'emptiness in sight' means that material phenomena (color) are essentially empty, and emptiness takes on a material form. This indicates that matter is not an eternal entity, but is constantly changing and has the nature of smoke, and is similar to the concept in the theory of relativity in modern physics that all matter is energy and that space-time is not fixed but fluid.


불교의 '눈에 보이는 공'은 물질적 현상(색)이 본질적으로 비어 있고, 비어 있음이 물질적인 형태를 취한다는 것을 의미한다. 이는 물질이 영원한 실체가 아니라 끊임없이 변화하며 연기의 성질을 갖고 있음을 나타내며, 모든 물질은 에너지이며 시공간은 고정된 것이 아니라 유동적이라는 현대 물리학의 상대성 이론의 개념과 유사하다.


The second law of thermodynamics states that as entropy increases, it leads to disorder, humans age and die, and the Earth and the universe are time bombs moving toward death and the end. A 'recurring decimal' refers to a decimal number in which a specific number after the decimal point is repeated infinitely, and 0.999... is mathematically the same as 1, expressing the real number 1 as another decimal. Satan Lucifer controls dark matter. 'Matter in the universe repeats itself cyclically. Escaping from the material world dominated by Satan is liberation in Buddhism, and salvation in Christianity.


열역학 제2법칙에 따르면 엔트로피가 증가하면 무질서가 생기고, 인간은 늙어 죽고, 지구와 우주는 죽음과 종말을 향해 움직이는 시한폭탄이다. 순환소수란 소수점 이하의 특정 숫자가 무한히 반복되는 소수를 말하며, 0.999...는 수학적으로 1과 동일하여 실수 1을 또 다른 소수로 표현한 것이다. 사탄 루시퍼는 암흑 물질을 통제합니다. '우주의 물질은 주기적으로 반복됩니다. 사탄이 지배하는 물질계에서 벗어나는 것이 불교에서는 해방이고, 기독교에서는 구원이다.






A prime number is the most basic number that can be compared to the atoms or elementary particles that form the basis of the material world, and is a number that is divided only by 1 and itself. Composite numbers (prime numbers and all natural numbers except 1) are made up of products of these prime numbers, similar to how all matter is made up of various combinations of different elements (prime numbers). Therefore, prime numbers are an indestructible basic unit in the world of numbers and play an important role in understanding the order of dark matter in the universe dominated by Satan Lucifer.

소수란 물질계의 근간을 이루는 원자나 소립자와 비교할 수 있는 가장 기본적인 수로, 1과 자기 자신으로만 나누어지는 수이다. 합성수(소수 및 1을 제외한 모든 자연수)는 이러한 소수의 곱으로 구성됩니다. 이는 모든 물질이 다양한 원소(소수)의 다양한 조합으로 구성되는 것과 유사합니다. 그러므로 소수는 수의 세계에서 불멸의 기본 단위이며, 사탄 루시퍼가 지배하는 우주에서 암흑 물질의 질서를 이해하는 데 중요한 역할을 한다.




In its symbolic meaning in the Bible, the number 2 symbolizes division, opposition, and separation, and can be used to represent complete separation from God. Meanwhile, the Pythagoreans viewed 1 as a point and 2 as a line, and believed that opposition and distinction begin at 2, which can be interpreted as representing the process of moving forward by separating from the complete beginning of 1.


성경에서 상징적 의미로 숫자 2는 분열, 반대, 분리를 상징하며, 하나님과의 완전한 분리를 나타내는 데 사용될 수 있습니다. 한편, 피타고라스학파는 1을 점으로, 2를 선으로 보았고, 대립과 구별이 2에서 시작된다고 믿었는데, 이는 1의 완전한 시작에서 분리되어 앞으로 나아가는 과정을 의미한다고 해석할 수 있다.




 The Eye of Horus holds a mathematical secret. It consists of six parts, each represented by a hieroglyphic symbol for a fraction with a numerator of 1, a symbol commonly used by the Babylonians and Egyptians of the time.


호루스의 눈은 수학적 비밀을 품고 있습니다. 여섯 부분으로 구성되어 있으며, 각 부분은 분자가 1인 분수를 나타내는 상형 문자로 표현되었는데, 이는 당시 바빌로니아인과 이집트인들이 흔히 사용했던 기호입니다.
The article argues that the Riemann Hypothesis, the pyramid of prime numbers, and the fractions associated with the Eye of Horus in quantum mechanics are deeply connected to human senses, particularly the law of diminishing returns. This law of diminishing returns is exemplified by the fact that when touch, taste, hearing, thinking, sight, and smell are represented as fractions of 1/64, 1/32, 1/16, 1/8, 1/4, and 1/2, respectively, the sum of these fractions is 63/64. Furthermore, it argues that this phenomenon is related to understanding animal mating behavior as a genetically programmed instinctive behavior.

이 논문은 리만 가설, 소수 피라미드, 그리고 양자역학에서 호루스의 눈과 관련된 분수가 인간의 감각, 특히 수확 체감의 법칙과 깊이 연관되어 있다고 주장합니다. 이 수확 체감의 법칙은 촉각, 미각, 청각, 사고, 시각, 후각을 각각 1/64, 1/32, 1/16, 1/8, 1/4, 1/2의 분수로 나타낼 때, 이 분수들의 합이 63/64라는 사실에서 잘 드러납니다. 더 나아가, 이 현상은 동물의 짝짓기 행동을 유전적으로 프로그램된 본능적 행동으로 이해하는 것과 관련이 있다고 주장합니다.


 있다고 주장합니다.

















The statement that all non-obvious zeros of the Riemann zeta function lie on a 'critical line' whose real part is 1/2 is the Riemann hypothesis, and is one of the most important unsolved problems in mathematics. On the other hand, the power-of-two fractions depicted in the Eye of Horus symbol are 1/64, 1/32, 1/16, 1/8, 1/4, and 1/2.

리만 제타 함수의 명백하지 않은 모든 0이 실수 부분이 1/2인 '임계선'에 있다는 진술은 리만 가설이며 수학에서 가장 중요한 미해결 문제 중 하나입니다. 반면에 호루스의 눈 기호에 묘사된 2의 거듭제곱 분수는 1/64, 1/32, 1/16, 1/8, 1/4, 1/2입니다.


1/32 represents taste and 1/16 represents hearing. Additionally, 1/8 represents thinking, 1/4 represents sight, and 1/2 represents smell.

Also, let's unify the denominator of the fraction shown in the Eye of Horus to 64. The denominator remains constant at 64 (1/64, 2/64, 4/64, 8/64, 16/64, 32/64), 


The sum of the molecules is 1+2+4+8+16+32=63.


1/32는 미각을 나타내고 1/16은 청각을 나타냅니다. 또한 1/8은 생각을 나타내고, 1/4은 시각을, 1/2은 냄새를 나타냅니다.

그리고 호루스의 눈에 표시된 분수의 분모를 64로 통일합시다. 분모는 64(1/64, 2/64, 4/64, 8/64, 16/64, 32/64)로 일정하게 유지되며, 


분자의 합은 1+2+4+8+16+32=63입니다.






<The presidential election is said to be held on June 3rd. Devil Cockroach Lee Jae-yong Samsung Group affiliates in total 63>

In the multiplication table, 6 x 3 is 18 = 666. 666 is the beast in the Book of Revelation.

<대선이 6월 3일에 치러진다고 합니다. 악마 바퀴벌레 이재용 삼성그룹 계열사 총 63개> 구구단에서 6 x 3은 18 = 666입니다. 666은 요한계시록에 나오는 짐승입니다.


What is truly shocking is that the Constitutional Court, the Samsung Republic, and the Chinese Communist Party zombie cockroaches scenario postponed the Yoon Seok-yeol impeachment trial for one reason.


<63 Samsung Electronics affiliates> To coincide with the presidential election date on June 3rd


The Constitution stipulates that a presidential election must be held within 60 days of impeachment.


Impeachment was announced on April 4,


June 3rd is in 60 days.

정말 충격적인 것은 헌법재판소와 삼성공화국, 중국 공산당의 좀비바퀴벌레 시나리오가 윤석열 탄핵심판을 연기한 이유가 하나라는 점이다.


<삼성전자 계열사 63개사> 6월 3일 대선일에 맞춰


헌법은 탄핵 후 60일 이내에 대통령 선거를 치러야 한다고 규정하고 있다.


4월 4일 탄핵이 발표됐다.


6월 3일은 60일 남았습니다.


* As can be seen from the pyramid, the representative symbol of the Illuminati, the future (world government, kingdom of the Antichrist) is a pyramid society that classifies humans into 33 (13) levels.


* 일루미나티의 대표적인 상징인 피라미드에서 알 수 있듯이 미래(세계정부, 적그리스도의 왕국)는 인간을 33(13)등급으로 분류하는 피라미드 사회이다.


At the top of this pyramid, the Antichrist, symbolized by the All-Sight (Eye of Horus), reigns as the ruler, and the 33rd degree or higher level Illuminati (Freemasons) rule the world with authority delegated from the Antichrist.


이 피라미드의 꼭대기에는 만능신(호루스의 눈)으로 상징되는 적그리스도가 통치자로 통치하고 있으며, 33급 이상의 일루미나티(프리메이슨)가 적그리스도로부터 위임받은 권위를 가지고 세계를 통치하고 있다.



The 'Eye of Horus in a pyramid/triangle' often symbolizes three straight lines and a circle, which are interpreted as the elements that make up the pyramid and the All-Eye (Eye of Horus). Here, three straight lines can represent the three sides of a pyramid, and a circle can represent a halo around the eye or the gaze of an omnipotent god, which has the same symbolic meaning as the pyramid and all-eyes depicted on the emblem of the US one-dollar bill.

'피라미드/삼각형 속 호루스의 눈'은 흔히 세 개의 직선과 원을 상징하는데, 이는 피라미드와 All-Eye(호루스의 눈)를 구성하는 요소로 해석됩니다. 여기서 직선 3개는 피라미드의 삼면을 의미할 수 있고, 원은 눈 주위의 후광 또는 전능한 신의 시선을 의미할 수 있는데, 이는 미국 1달러 지폐의 엠블럼에 그려진 피라미드와 눈 전체와 같은 상징적 의미를 갖는다.





Horn of Cornuto


Freemasons use this sign to signify their allegiance to Satanism.


It is said to be the horn of Satan. It is also called the horn of the devil (devil) and the horn of Lucifer. Korean celebrities and singers also habitually sign this sign of Satan.


코르누토의 뿔


프리메이슨은 이 표시를 사용하여 사탄주의에 대한 충성을 나타냅니다.


사탄의 뿔이라고 합니다. 마귀(마귀)의 뿔, 루시퍼의 뿔이라고도 합니다. 한국의 연예인과 가수들도 습관적으로 이 사탄의 표시에 서명합니다.



A hand shape known as the devil's sign or devil's horns.


It is used as a sign of greeting among Satanists and is said to be a sign of recognition and loyalty among servants of Lucifer in the Satanic Bible.A hand shape known as the devil's sign or devil's horns.


악마의 표시 또는 악마의 뿔로 알려진 손 모양.




사탄숭배자들 사이에서는 인사의 표시로 사용되며, 사탄성서에서는 루시퍼의 종들 사이에서 인정과 충성의 표시로 사용된다고 합니다. 악마의 표시 또는 악마의 뿔로 알려진 손 모양입니다.



Satan Lucifer Dark Matter Zombie Parasite The summit between Trump and Jae Myung Lee means that zombies act like computer programs. Quantum mechanics, Riemann hypothesis, prime number 0, evil eye, Pyramid of Giza in Hors, Egypt.

사탄루시퍼 암흑물질 좀비 기생충 트럼프와 이재명의 정상회담은 좀비가 컴퓨터 프로그램처럼 행동한다는 뜻이다. 양자역학, 리만 가설, 소수 0, 악마의 눈, 이집트 호르스에 있는 기자의 피라미드.

Satan Illuminati Zombie Subcontract Factory Samsung Electronics Demon Parasite Jaeyong Lee South Korea's police, prosecutors, courts, media, broadcasters, politicians, and the zombie parasites that control them act like trash and offer human sacrifices to Satan through rigged elections and terrorism. 

Riemann Hypothesis Riemann Hypothesis Zero Points Prime Numbers and Quantum Mechanics and the Egyptian Pyramids of Giza Horus Eye of the Beast and Animal Mating Instincts Unconsciousness Second Law of Thermodynamics in the Universe The law of entropy increase that leads to disorder is the same

사탄 일루미나티 좀비 하청공장 삼성전자 악마 기생충 이재용 대한민국의 경찰, 검찰, 법원, 언론, 방송사, 정치인, 그리고 그들을 조종하는 좀비 기생충들은 부정선거와 테러를 통해 사탄에게 인간 제물을 바치는 쓰레기 행세를 하고 있습니다. 

리만 가설 리만 가설 영점 소수와 양자 역학과 기자의 이집트 피라미드 호루스 짐승의 눈과 동물의 짝짓기 본능 무의식 우주의 열역학 제2법칙 무질서를 초래하는 엔트로피 증가의 법칙은 같다







The zero point of Satan's animal instincts and unconsciousness, the quantum mechanics that governs the material world, and the Riemann Zeta function, that is, the point where the function value is 0, are distributed along a specific straight line.
 Additionally, zero point, prime number, pyramid, zero dimension, circulation, quantum mechanics, etc. are keywords used to understand and approach the Riemann hypothesis.

사탄의 동물적 본능과 무의식의 영점, 물질계를 지배하는 양자역학과 리만 제타 함수, 즉 함수값이 0이 되는 지점이 특정한 직선을 따라 분포되어 있다.
 또한 영점, 소수, 피라미드, 영차원, 순환, 양자역학 등은 리만 가설을 이해하고 접근하는 데 사용되는 키워드이다.













2 Corinthians <11:14> Even the devil Lucifer disguises himself as an angel of light.

고린도후서 <11:14> 마귀 루시퍼도 자기를 빛의 천사로 가장합니다.









This blogger's judgment is that Korea's No. 1 Illuminati devil parasite Hong Seok-hyun and devil cockroach Lee Jae-yong, chairman of Samsung Electronics, elected zombie parasite Lee Jae-myeong through a fraudulent election and made him go through the Satan Lucifer Illuminati approval process (coronation ceremony) through the 'Appointment Ceremony of Light' held this time.


본 블로거의 판단은 대한민국 1위 일루미나티 악마 기생충 홍석현과 악마 바퀴벌레 이재용 삼성전자 회장이 부정선거를 통해 좀비 기생충 이재명을 선출하고 이번에 열린 '빛의 임명식'을 통해 사탄 루시퍼 일루미나티 승인 절차(대관식)를 거치게 했다는 것이다.



Lee Jae-myung could not overcome the judicial risk of the court led by Cho Hee-dae and could have fallen by the wayside, but at a critical moment, Hong Seok-hyun (Samsung) Lee Jae-yong stepped in and eliminated the last judicial risk, allowing Lee Jae-myung to become president.



​이재명은 조희대가 이끄는 법원의 사법리스크를 이기지 못하고 낙오될 수도 있었지만, 결정적인 순간 홍석현(삼성) 이재용이 개입해 마지막 사법리스크를 제거해 이재명이 대통령이 될 수 있도록 했다.







The Riemann hypothesis, which governs Satan's animal instincts, the unconscious mind, and the material world, is a conjecture that the zero points of the Riemann zeta function, that is, points where the function value is 0, are distributed on a specific straight line. This hypothesis is closely related to the distribution of prime numbers and is considered a mathematical challenge. Additionally, zero point, prime number, pyramid, zero dimension, circulation, quantum mechanics, etc. are keywords used to understand and approach the Riemann hypothesis.

사탄의 동물적 본능과 무의식, 물질세계를 관장하는 리만가설은 리만 제타함수의 영점, 즉 함수값이 0이 되는 점이 특정한 직선상에 분포되어 있다는 추측이다. 이 가설은 소수의 분포와 밀접하게 관련되어 있으며 수학적 도전으로 간주됩니다. 또한 영점, 소수, 피라미드, 영차원, 순환, 양자역학 등은 리만 가설을 이해하고 접근하는 데 사용되는 키워드이다.




The expression “only one out of 300 million sperm fertilizes an egg” symbolizes the enormous competition and low probability in the reproductive process, which metaphorically indicates that the survival of a startup or self-employed business with a high failure rate of 90% is very difficult and is achieved through fierce competition. The fact that only one success is achieved out of numerous attempts emphasizes how low-probability and rare the birth of human life is, and suggests that social success is similarly the result of fierce competition that leaves only a very small number of successes.


“3억 개의 정자 중 단 한 개만이 난자를 수정시킨다”는 표현은 생식 과정에서 엄청난 경쟁과 낮은 확률을 상징하며, 이는 90%의 높은 실패율을 겪는 스타트업이나 자영업의 생존이 매우 어렵고 치열한 경쟁을 통해 달성된다는 것을 은유적으로 나타냅니다. 수많은 시도 끝에 단 한 번만 성공한다는 사실은 인간 생명의 탄생이 얼마나 확률이 낮고 희소한 것인지를 강조하며, 사회적 성공 역시 극소수의 성공만을 남기는 치열한 경쟁의 결과임을 시사한다.


The given passage metaphorically expresses the process of restoring 'order' through learning and recovery, which leads to growth through learning and recovery, just as the second law of thermodynamics explains the increase in entropy, which means disorder. It suggests that just as discrimination and distinction are essential characteristics in the material world, humans also achieve essential growth through failure.

주어진 구절은 무질서를 의미하는 엔트로피의 증가를 열역학 제2법칙이 설명하는 것처럼, 학습과 회복을 통해 '질서'를 회복하고, 이것이 학습과 회복을 통해 성장으로 이어지는 과정을 은유적으로 표현하고 있다. 물질세계에서 차별과 차별이 본질적인 특성이듯이, 인간 역시 실패를 통해 본질적인 성장을 이룬다는 점을 시사한다.


This refers to the conjecture that the zero points of the Riemann zeta function will exist on a specific straight line (critical line). The other is an explanation of the social concept that discrimination in the material world means social inequality.


이는 리만 제타 함수의 영점이 특정 직선(임계선) 위에 존재할 것이라는 추측을 말합니다. 다른 하나는 물질계의 차별이 사회적 불평등을 의미한다는 사회적 개념에 대한 설명이다.


Satan Lucifer Entropy increases in an isolated system according to the second law of thermodynamics governed by the mass and gravity of dark matter, and similarly, the fact that the energy level distribution of quantum mechanics is related to the non-obvious zero distribution of the Riemann zeta function provides an important link to understanding the Riemann hypothesis through physical principles. This similarity shows the deep connection between physics and mathematics and opens up the possibility of analyzing the Riemann hypothesis for the distribution of prime numbers from a physical perspective.


사탄 루시퍼 엔트로피는 암흑 물질의 질량과 중력에 의해 지배되는 열역학 제2법칙에 따라 고립계에서 증가하며, 마찬가지로 양자역학의 에너지 준위 분포가 리만 제타 함수의 불명확한 영 분포와 관련되어 있다는 사실은 리만 가설을 물리적 원리를 통해 이해하는 데 중요한 연결고리를 제공합니다. 이러한 유사성은 물리학과 수학 사이의 깊은 연관성을 보여주며 소수 분포에 대한 리만 가설을 물리적 관점에서 분석할 수 있는 가능성을 열어줍니다.


To put it simply, the meeting between Trump, a zombie parasite ruled by Satan Lucifer, and Lee Jae-myung is like a program with obvious results.


쉽게 말하면 사탄 루시퍼가 지배하는 좀비 기생충 트럼프와 이재명의 만남은 결과가 뻔한 프로그램 같다.


According to the second law of thermodynamics, all systems progress in the direction of increasing entropy (disorder) over time, but living organisms can exhibit a phenomenon similar to 'God's order' by using external energy to lower entropy (maintain order) and further increase the entropy of the surrounding environment. It is argued that humans' repetitive failure and learning process is also a process of learning from disorderly failures, trying again, and restoring order, and this is similar to the principle of growth by resisting the law of entropy increase.



열역학 제2법칙에 따르면 모든 계는 시간이 지남에 따라 엔트로피(무질서)가 증가하는 방향으로 진행되지만, 생명체는 외부 에너지를 이용하여 엔트로피를 낮추고(질서를 유지) 주변 환경의 엔트로피를 더욱 증가시킴으로써 '신의 질서'와 유사한 현상을 나타낼 수 있다. 인간의 반복적인 실패와 학습과정 역시 무질서한 실패로부터 배우고, 다시 시도하고, 질서를 회복하는 과정이라고 주장하는데, 이는 엔트로피 증가의 법칙에 저항하여 성장의 원리와 유사하다.

A communist country based on materialism can oppress or discriminate against individual human rights based on ideology, while a dictatorial country restricts freedom and rights and commits human rights violations for the sake of the ruler's power. In both systems, discrimination and oppression occur for the benefit of a particular ideology or ruler, which goes against the basic human rights principle of respect for human dignity.

물질주의에 기초한 공산주의 국가는 이념에 기초하여 개인의 인권을 억압하거나 차별할 수 있는 반면, 독재국가는 통치자의 권력을 위해 자유와 권리를 제한하고 인권침해를 자행한다. 두 체제 모두 특정 이념이나 지배자의 이익을 위해 차별과 억압이 발생하는데, 이는 인간 존엄성 존중이라는 인권 기본 원칙에 어긋나는 것이다.


In Buddhism, the insight that all life is fundamentally the same is connected to the ideas of non-self, emptiness, and dependent origination. These ideas teach the truth that all beings are interdependent and interconnected, not the independence of the individual self. This interconnectedness leads to the possibility of **Buddhahood**, where all sentient beings can become Buddha, a process that allows them to overcome suffering, escape from the material world, and advance into the spiritual world, leading to ultimate **liberation (nirvana)**.


불교에서는 모든 생명이 근본적으로 동일하다는 통찰은 무아, 공, 연기의 사상과 연결됩니다. 이러한 사상은 모든 존재가 개별적 자아의 독립성이 아니라 상호 의존적이고 상호 연결되어 있다는 진리를 가르칩니다. 이러한 상호 연결성은 모든 중생이 부처가 될 수 있는 **부처**의 가능성으로 이어지며, 이는 고통을 극복하고 물질계에서 벗어나 영적 세계로 진출하여 궁극적인 **해탈(열반)**에 이르게 하는 과정입니다.


The statement “I am no different from the Buddha” refers to the similarity between the Buddhist perspective and some religions, and according to the teachings of Jesus Christ, this cannot be seen in the same context as the claim that I am no different from the Christian God. The realization that Jesus Christ is a human body and is no different from God applies to all humans.


“나는 부처님과 다르지 않다”는 말은 불교적 관점과 일부 종교의 유사성을 말하며, 예수 그리스도의 가르침에 따르면 이는 내가 기독교의 신과 다르지 않다는 주장과 같은 맥락으로 볼 수 없다. 예수 그리스도가 인간의 몸이시며 하나님과 다르지 않으시다는 깨달음은 모든 인간에게 적용됩니다.


In Christianity, the 'spirit of slavery' refers to the state of living in fear and oppression bound by sin and Satan, and the 'spirit of adoption' means gaining freedom by enjoying an intimate relationship with God through the Holy Spirit that can be called Abba and Father. Christians receive the 'Spirit of Adoption' through the Holy Spirit, free themselves from the previous yoke of the law and the bondage of sin, and enjoy a new relationship in Christ, that is, the freedom and privilege of calling God Father.


기독교에서 '종의 영'은 죄와 사탄에 속박되어 두려움과 억압 속에 사는 상태를 말하는 것이고, '양자의 영'은 아바 아버지라 할 수 있는 성령을 통하여 하나님과 친밀한 관계를 누리며 자유를 얻는 것을 의미합니다. 그리스도인은 성령을 통해 '양자의 영'을 받아 이전의 율법의 멍에와 죄의 속박에서 벗어나 그리스도 안에서 새로운 관계, 즉 하나님을 아버지라 부르는 자유와 특권을 누리게 됩니다.


It is said that if you interact with the material world dominated by Satan, you cannot leave the material world, but only through enlightenment can you remove and overcome Satan Lucifer's dark matter interference and interaction and move on to a free spiritual world.


사탄이 지배하는 물질세계와 교류하면 물질세계를 떠날 수 없지만 깨달음을 통해서만 사탄 루시퍼의 암흑물질 간섭과 상호작용을 제거하고 극복하여 자유로운 영적 세계로 나아갈 수 있다고 합니다.


The cross of Jesus is a symbol of resistance to the material world under Satan's control, and the cross and resurrection of Jesus Christ have a symbolic meaning of decisively breaking the power of Satan and providing believers with the strength to overcome sin and death. According to the Bible, Satan operates without God's permission and tempts humans, but the cross of Jesus Christ acts as God's ultimate solution to destroy Satan's power and save humans from the state of sin and death.


예수님의 십자가는 사탄의 지배를 받는 물질세계에 대한 저항의 상징이며, 예수 그리스도의 십자가와 부활은 사탄의 권세를 결정적으로 무너뜨리고 신자들에게 죄와 죽음을 이길 수 있는 힘을 주시는 상징적 의미를 갖고 있습니다. 성경에 따르면 사탄은 하나님의 허락 없이 역사하며 인간을 유혹하지만, 예수 그리스도의 십자가는 사탄의 세력을 멸하고 인간을 죄와 죽음의 상태에서 구원하는 하나님의 궁극적인 해결책으로 작용합니다.


In the Bible, the expression that Satan 'dominates' the material world means that, as the god of this world, he deceives the hearts of non-believers and binds them with false teachings, and this is a temporary and limited influence allowed under God's sovereignty. Satan's power has a great influence on this world and its people, but it does not mean Satan's complete domination because God determined the scope of its activities and ultimately trampled on Satan's power through Christ.

성경에서 사탄이 물질세계를 '지배한다'는 표현은 이 세상의 신으로서 불신자들의 마음을 속이고 거짓 가르침으로 그들을 결박한다는 뜻인데, 이는 하나님의 주권 하에서 허용되는 일시적이고 제한적인 영향력이다. 사단의 세력은 이 세상과 이 세상 사람들에게 큰 영향력을 끼치지만, 그것이 사단의 완전한 지배를 의미하는 것은 아니다. 왜냐하면 하나님께서 사단의 활동 범위를 정하시고 궁극적으로 그리스도를 통하여 사단의 세력을 짓밟으시기 때문이다.


Christians who reject material power like Jesus Christ are not ruled by Satan, but are people who belong to the kingdom of God, which has already begun with the reign of Jesus. This world is still imperfect because of the power of Satan, but faith that rejects worldly values ​​and follows God's will becomes a shortcut to escaping the material world and entering the spiritual kingdom of God, thereby achieving salvation.


예수 그리스도와 같은 물질적 권력을 거부하는 그리스도인은 사탄의 통치를 받는 것이 아니라, 예수님의 통치로 이미 시작된 하나님 나라에 속한 사람들입니다. 이 세상은 여전히 ​​사단의 세력으로 인해 불완전하지만, 세상의 가치관을 거부하고 하나님의 뜻을 따르는 믿음은 물질세계에서 벗어나 영적 하나님의 나라에 들어가 구원을 이루는 지름길이 됩니다.


‘I am not different from the Buddha, and I am not different from God’ means overcoming discrimination between substances and phenomena and achieving the realization of nirvana that all beings are inherently one. This is a process of realizing the nature that is already within us, and is a process of experiencing the true equality that everything is equal beyond the ideological level. It is a difficult task because it involves overcoming the differences inherent in the material itself and realizing the essential oneness of existence.


'나는 부처와 다르지 않고, 신과 다르지 않다'는 것은 물질과 현상의 차별을 극복하고 모든 존재가 본질적으로 하나라는 열반의 실현을 의미합니다. 이는 이미 우리 안에 있는 본성을 깨닫는 과정이며, 이념적 차원을 넘어 모든 것이 평등하다는 진정한 평등을 경험하는 과정이다. 물질 자체에 내재된 차이를 극복하고 존재의 본질적인 일체성을 구현하는 일이기 때문에 어려운 작업이다.


It is a well-known fact that the conjecture that the root (0) of the Riemann zeta function is arranged on a specific line (critical line) in the Riemann hypothesis is similar to the phenomenon of quantum mechanics in which the energy level of a particle is quantized to a specific value. This similarity is related to the operator spectrum theory of quantum mechanics and is the basis of the Hilbert-Folia conjecture, one approach to proving the Riemann hypothesis. However, this similarity is directly related to the mating instinct of animals, the unconscious, and the patterns of all materials. This is the dark matter controlled by Satan Lucifer.


리만 가설에서 리만 제타 함수의 근(0)이 특정 선(임계선)에 배열된다는 추측은 입자의 에너지 준위가 특정 값으로 양자화되는 양자역학 현상과 유사하다는 것은 잘 알려진 사실이다. 이러한 유사성은 양자역학의 연산자 스펙트럼 이론과 관련이 있으며 리만 가설을 증명하는 한 가지 접근법인 힐베르트-폴리아 추측의 기초가 됩니다. 그러나 이러한 유사성은 동물의 짝짓기 본능, 무의식, 모든 물질의 패턴과 직결된다. 이것은 사탄 루시퍼가 조종하는 암흑물질입니다.


According to the second law of thermodynamics, as entropy increases, disorder occurs, humans grow old and die, and the Earth and the universe are time bombs moving toward death and apocalypse. A repeating decimal refers to a decimal in which a specific number after the decimal point repeats infinitely. 0.999... is mathematically equivalent to 1, so the real number 1 is expressed as another decimal. Satan Lucifer controls dark matter. 'Matter in the universe repeats itself cyclically. Escaping from the material world dominated by Satan is liberation in Buddhism and salvation in Christianity.

열역학 제2법칙에 따르면 엔트로피가 증가할수록 무질서가 발생하고 인간은 늙고 죽으며, 지구와 우주는 죽음과 종말을 향해 움직이는 시한폭탄이다. 반복소수는 소수점 이하의 특정 숫자가 무한히 반복되는 소수를 말한다. 0.999...는 수학적으로 1과 동일하므로 실수 1은 또 다른 소수로 표현됩니다. 사탄 루시퍼는 암흑 물질을 통제합니다. '우주의 물질은 주기적으로 반복됩니다. 사탄이 지배하는 물질계에서 벗어나는 것이 불교에서는 해탈 기독교에서는 구원이다.


The statement that all non-obvious zeros of the Riemann zeta function lie at the 'critical line' where the real part is 1/2 is the Riemann hypothesis and is one of the most important unsolved problems in mathematics. On the other hand, the power-of-two fractions depicted in the Eye of Horus symbol are 1/64, 1/32, 1/16, 1/8, 1/4, and 1/2. 1/32 represents taste and 1/16 represents hearing. Additionally, 1/8 represents thoughts, 1/4 represents sight, and 1/2 represents smell.


리만 제타 함수의 명백하지 않은 모든 0이 실수 부분이 1/2인 '임계선'에 있다는 진술은 리만 가설이며 수학에서 가장 중요한 미해결 문제 중 하나입니다. 반면에 호루스의 눈 기호에 묘사된 2의 거듭제곱 분수는 1/64, 1/32, 1/16, 1/8, 1/4, 1/2입니다. 1/32는 미각을 나타내고 1/16은 청각을 나타냅니다. 또한 1/8은 생각, 1/4은 시각, 1/2은 냄새를 나타냅니다.


And let us unify the denominator of the fraction shown in the Eye of Horus to 64. The denominator remains constant at 64 (1/64, 2/64, 4/64, 8/64, 16/64, 32/64). 


In binary numbers, starting from the 1 digit, adding up all the powers of 1/2 for each number equals 0.999.



The sum of the molecules is 1+2+4+8+16+32=63.






그리고 호루스의 눈에 표시된 분수의 분모를 64로 통일합시다. 분모는 64(1/64, 2/64, 4/64, 8/64, 16/64, 32/64)로 일정하게 유지됩니다. 


이진수에서는 1자리부터 시작하여 각 숫자에 대한 1/2의 거듭제곱을 모두 더하면 0.999가 됩니다.



분자의 합은 1+2+4+8+16+32=63입니다.





<The presidential election is said to be held on June 3rd. Devil Cockroach Lee Jae-yong Samsung Group affiliates in total 63>

In the multiplication table, 6 x 3 is 18 = 666. 666 is the beast in the Book of Revelation.

<대선이 6월 3일에 치러진다고 합니다. 악마 바퀴벌레 이재용 삼성그룹 계열사 총 63개> 구구단에서 6 x 3은 18 = 666입니다. 666은 요한계시록에 나오는 짐승입니다.


What is truly shocking is that the Constitutional Court, the Samsung Republic, and the Chinese Communist Party zombie cockroaches scenario postponed the Yoon Seok-yeol impeachment trial for one reason.


<63 Samsung Electronics affiliates> To coincide with the presidential election date on June 3rd


The Constitution stipulates that a presidential election must be held within 60 days of impeachment.


Impeachment was announced on April 4,


June 3rd is in 60 days.

정말 충격적인 것은 헌법재판소와 삼성공화국, 중국 공산당의 좀비바퀴벌레 시나리오가 윤석열 탄핵심판을 연기한 이유가 하나라는 점이다.


<삼성전자 계열사 63개사> 6월 3일 대선일에 맞춰


헌법은 탄핵 후 60일 이내에 대통령 선거를 치러야 한다고 규정하고 있다.


4월 4일 탄핵이 발표됐다.


6월 3일은 60일 남았습니다.




0.999... is a repeating decimal number with infinite repetitions of 9, and is another decimal representation of the real number 1. Mathematically, 0.999... and 1 have the same value, and are equivalent because no other number can exist between 1 and 0.999.... This can be proven in a variety of ways, such as an algebraic proof or multiplying 1/3 by 3. Satan's dark matter dominates the universe's material cycle, a material world that repeats itself.


0.999...는 9가 무한히 반복되는 반복 십진수이며 실수 1의 또 다른 십진수 표현입니다. 수학적으로 0.999...와 1은 같은 값을 가지며 1과 0.999 사이에는 다른 숫자가 존재할 수 없기 때문에 동일합니다. 이는 대수적 증명이나 1/3에 3을 곱하는 등 다양한 방법으로 증명할 수 있습니다. 사탄의 암흑 물질은 우주의 물질을 지배합니다 순환, 반복되는 물질 세계.



In Gematria numerology, the expression "6 can 'go no further' than the number 9" is interpreted to mean that 6 and 9 do not change each other's literal and symbolic forms and that numbers have not reached perfection (10). 6 symbolizes incompleteness and material desires, 9 represents 10 unfinished, but 6 and 9 have limited meaning in themselves and represent a state in which no further progress can be made.


게마트리아 수비학에서 "6은 숫자 9보다 '더 이상 나아갈 수 없다'"는 표현은 6과 9가 서로의 문자적, 상징적 형태를 바꾸지 않으며 숫자가 완전함에 도달하지 못했다는 의미로 해석됩니다(10). 6은 불완전함과 물질적 욕망을 상징하고, 9는 미완성인 10을 의미하지만, 6과 9는 그 자체로 제한된 의미를 가지며 더 이상 발전할 수 없는 상태를 나타낸다.



The Pyramid of Giza's north latitude (29.9792458^) is the same from the speed of light (299,792,458m) to 9 decimal places <Why is there no beginning in Chapter 9 of the Quran?>

기자의 피라미드는 북위(29.9792458^)가 빛의 속도(299,792,458m)부터 소수점 9자리까지 동일하다 <꾸란 9장에는 왜 시작이 없는가?>


2 Corinthians <11:14> Even the devil Lucifer disguises himself as an angel of light.

고린도후서 <11:14> 마귀 루시퍼도 자기를 빛의 천사로 가장합니다.


The northern latitude coordinates of the Great Pyramid of Giza are known to be approximately (29.9792458^). This number can be observed starting with (299,792,458 m) to 9 decimal places, which corresponds to the speed of light in a vacuum. The Quran consists of 114 chapters. Of these, all 113 chapters except Chapter 9 begin with the phrase, “In the name of Allah, the Gracious, the Merciful.”


<Why is there no beginning in Chapter 9 of the Quran?>

기자의 대 피라미드의 북위 좌표는 대략 (29.9792458^)로 알려져 있습니다. 이 숫자는 (299,792,458m)부터 소수점 9자리까지 관찰할 수 있으며, 이는 진공에서 빛의 속도에 해당합니다. 꾸란은 114장으로 구성되어 있다. 이 중 9장을 제외한 113개 장은 모두 “은혜로우시고 자비로우신 알라의 이름으로”라는 문구로 시작된다.


<꾸란 9장에는 왜 시작 부분이 없나요?>


2 Corinthians <11:14> Even the devil Lucifer disguises himself as an angel of light. 




Why COVID-19?






The Quran consists of 114 chapters (19×6). The total number of verses in the Quran, including all unnumbered Bismillahs, is 6346 (19 x 334). The sum of 6346 is 19. Bismillah appears 114 times.






The first verse, “Bismillah…” consists of 19 letters. The Quran consists of 114 surahs, so 19 x 6. The total number of verses in the Quran is 6346 = 6 + 3 + 4 + 6 = 19.



고린도후서 <11:14> 마귀 루시퍼도 자기를 빛의 천사로 가장합니다. 




왜 코로나19인가?






꾸란은 114장(19×6)으로 구성되어 있다. 번호가 매겨지지 않은 모든 비스밀라를 포함하여 꾸란의 총 구절 수는 6346(19 x 334)입니다. 6346의 합은 19입니다. 비스밀라(Bismillah)는 114번 나타납니다.






첫 번째 구절인 “비스밀라…”는 19개의 글자로 구성되어 있습니다. 꾸란은 114개의 수라로 구성되어 있으므로 19 x 6입니다. 꾸란의 총 구절 수는 6346 = 6 + 3 + 4 + 6 = 19입니다.



half-youngest sister Lee Yun-hyeong, who was murdered by Samsung Electronics Chairman Lee Jae-yong Date of death November 19, 2005 =2+5+1+1+1+9=19= Why "Number 19"? covid-19? 

Why "Number 19"?

19: It has magical meaning. It is also a number symbolizing the Second Coming.

The number 19 is also a number used to cause events/accidents or make blood sacrifices based on the natural phenomenon of the sun and moon having the same cycle every 19 years.

Therefore, Satan's servants symbolize the number 19, signifying the ongoing human and blood sacrifices for Satan.

At the same time, they called themselves the high priests of Satan.

So Satan's servants use it as a kind of performance to remind themselves that Satan is their master.

이재용 삼성전자 회장에게 살해된 이복동생 이윤형 사망일 2005년 11월 19일 =2+5+1+1+1+9=19= 왜 '19번'인가? 

코로나 19? 왜 "19번"인가? ​ 

19: 마법 같은 의미가 있어요. 재림을 상징하는 숫자이기도 합니다. ​ 

19라는 숫자는 해와 달이 19년을 주기로 같은 주기를 갖는 자연현상에 기초하여 사건/사고를 일으키거나 피의 제사를 드리는 데 사용되는 숫자이기도 합니다. ​ 그러므로 사탄의 종들은 숫자 19를 상징하며, 이는 사탄을 위한 계속되는 인간과 피의 희생을 의미합니다. ​ 동시에 그들은 스스로를 사탄의 대제사장이라 불렀습니다. ​ 그래서 사탄의 종들은 그것을 사탄이 그들의 주인임을 스스로 상기시키기 위한 일종의 공연으로 이용합니다.




In Islamic numerology, the number 19 represents the value of 'Wahed' (Arabic for "one").

For example, in the Islamic faith, the number 19 is mentioned in the Quran and is associated with the miraculous nature of the scripture. The numerical value of the word 'Allah' (God) in Arabic is 19, symbolizing strange energy.

이슬람 수비학에서 숫자 19는 '와헤드(아랍어로 "하나")'의 가치를 나타냅니다.

예를 들어, 이슬람 신앙에서 숫자 19는 쿠란에 언급되며 경전의 기적적인 본질과 연관됩니다. 아랍어로 '알라(신)'라는 단어의 숫자 값은 19이며, 이는 기묘한 에너지를 상징합니다.






Likewise, the number 19 is very important in the Baha'i faith. It is associated with the Baha'i calendar, which consists of 19 months and 19 days. This unique calendar system reflects the Baha'i faith in the unity and harmony of all religions and cultures. Moreover, the meaning of number 19 can be found in other fields such as science and mathematics. In chemistry, potassium, an element essential for life, has atomic number 19. Additionally, 19 is a prime number, indicating its indivisibility and uniqueness.

마찬가지로, 바하이 신앙에서는 숫자 19가 매우 중요합니다. 이는 19개월과 19일로 구성된 바하이 달력과 관련이 있습니다. 이 독특한 달력 체계는 모든 종교와 문화의 통합과 조화를 믿는 바하이 신앙을 반영합니다.

게다가 숫자 19의 의미는 과학, 수학 등 다른 분야에서도 찾아볼 수 있다. 화학에서 생명에 꼭 필요한 원소인 칼륨은 원자번호 19번을 갖고 있습니다. 또한 19는 소수로서 그 불가분성과 유일성을 나타냅니다.

urrently, the scope of the longitudinal safety zone varies by domestic airport. The distance from Muan Airport is 199M =199m=199=1+9+9=19 Illuminati Numerology

현재 종방향 안전지대의 범위는 국내공항별로 다양하다. 무안공항의 거리는 199M =199m=199=1+9+9=19 일루미나티 수비학


Muan Airport in South Jeolla Province, South Korea, uses one runway divided into '01', which operates to the north, and '19', which operates to the south, depending on the flight direction.

대한민국 전라남도 무안공항은 비행 방향에 따라 북쪽으로 운행하는 '01'과 남쪽으로 운행하는 '19'로 나누어 하나의 활주로를 사용한다.


Jeollanam-do Muan Airport opening date: November 8, 2007 = 2+7+1+1+8=19 Muan Airport promoted to international airport December 8, 2024 = 19 Illuminati numerology Muan Airport terror attack after 21 days

전라남도 무안공항 개항 날짜 2007년 11월8일=2+7+1+1+8=19

무안공항 국제공항 승격 2024년12월8일=19 일루미나티 수비학


"Putting up a concrete wall is like a criminal act," aviation expert David

Rearmount told Britain's Sky News.

항공 전문가 데이비드 리어마운트는 영국 스카이 뉴스와의 인터뷰에서 "콘크리트 벽을 세우는 것은 범죄 행위와 같습니다."라고 말했습니다.

"19 concrete pillars are driven in" means that what looks like a pile of dirt at first glance is actually 19 concrete pillars driven in tightly. In other words, it means that the structure is much stronger and more solid than expected. For example, it is an expression that describes that the internal structure is supported more solidly than it appears on the outside, such as a localizer facility.


"콘크리트 기둥 19개가 박혀 있다"는 말은 언뜻 보기에 흙더미처럼 보이는 것이 사실은 콘크리트 기둥 19개가 촘촘히 박혀 있다는 것을 의미합니다. 다시 말해, 구조물이 예상보다 훨씬 더 강하고 견고하다는 것을 의미합니다. 예를 들어, 로컬라이저 시설처럼 내부 구조물이 겉보기보다 더 견고하게 지지된다는 것을 표현하는 표현입니다.


The Constitutional Court opens on January 14, the first day of the impeachment trial. 114?

헌법재판소는 탄핵 재판의 첫 날인 1월 14일에 개원합니다. 114




The term “the last days” appears once in the 14th chapter of the Lotus Sutra, “The Chapter on Comfortable Conduct.” In Buddhism, the term “the last days” can be seen as “the five turbid evil worlds.” The five turbid evil worlds (五濁惡世) mean “five impurities.” The world we live in now is called the “last days.” This is because it is an era in which the karma of the five turbid evil worlds runs rampant. The various social evils and mental and physiological evils that cannot be avoided wherever people live are classified into five categories and called the five turbid evil worlds (五濁惡世). It means a dirty world teeming with impure negativity.

"말세(末世)"라는 용어는 법화경 14편 "편행품(偏行品)"에 한 번 등장합니다. 불교에서 "말세"라는 용어는 "오탁악세계(五濁惡世)"로 볼 수 있습니다. 오탁악세계(五濁惡世)는 "다섯 가지 부정함"을 의미합니다. 지금 우리가 사는 세상을 "말세"라고 부릅니다. 오탁악세계의 업이 횡행하는 시대이기 때문입니다. 사람들이 사는 곳 어디에서나 피할 수 없는 여러 가지 사회적 악과 정신적, 생리적 악을 다섯 가지로 분류하여 오탁악세계(五濁惡世)라고 합니다. 불순한 부정으로 가득 찬 더러운 세상을 의미합니다.







When using an air conditioner, order appears to increase (entropy decreases) by lowering the indoor temperature, but the power consumed to operate the air conditioner is converted into heat and discharged outdoors, causing an increase in outdoor entropy, which increases the disordered entropy of the entire system.

에어컨을 사용하면 실내 온도를 낮추어 질서가 증가(엔트로피 감소)하는 것처럼 보이지만, 에어컨을 작동하는데 소비되는 전력이 열로 변환되어 실외로 배출되므로 실외 엔트로피가 증가하게 되어 전체 시스템의 무질서한 엔트로피가 증가하게 됩니다.


This is similar to the process by which living things maintain order using energy, but ultimately increase overall disorder. What is important is that artificial systems such as air conditioners require someone to press a switch that requires input of external energy. Unfortunately, as the population grows, carbon dioxide and disorderly entropy increase.

이는 생명체가 에너지를 이용해 질서를 유지하다가 궁극적으로 전체적인 무질서를 증가시키는 과정과 유사하다. 중요한 것은 에어컨과 같은 인공 시스템은 외부 에너지의 입력이 필요한 스위치를 누군가가 눌러야 한다는 것입니다. 불행히도 인구가 증가함에 따라 이산화탄소와 무질서한 엔트로피가 증가합니다.


Living things, including humans, eat other living things to maintain order. All living things eat other living things to survive and gain energy. In this process, it destroys the surrounding order and increases disorder, which is a natural phenomenon that leads to an increase in entropy of the Earth and the entire universe. In other words, the very existence of life contributes to an increase in the entropy of the universe, which is linked to human aging and death and the process toward the end of the universe.




인간을 포함한 생물은 질서를 유지하기 위해 다른 생물을 잡아먹는다. 모든 생명체는 생존과 에너지를 얻기 위해 다른 생명체를 먹습니다. 이 과정에서 주변 질서를 파괴하고 무질서를 증가시키는 것은 지구와 우주 전체의 엔트로피 증가로 이어지는 자연스러운 현상이다. 즉, 생명의 존재 자체가 우주의 엔트로피 증가에 기여하며, 이는 인간의 늙음과 죽음, 그리고 우주의 종말을 향한 과정과도 연결된다.


Humans are Satan's zombies who destroy, sacrifice, and eat the order of other animal and plant life forms in order to maintain the energy order of their own bodies.

인간은 자신의 몸의 에너지 질서를 유지하기 위해 다른 동식물의 질서를 파괴하고, 희생하고, 잡아먹는 사탄의 좀비이다.











Satan's dark matter is hidden behind the chaos of Nazi demons who massacred countless innocent Jews for the sake of Germany's comfortable order.


독일의 안락한 질서를 위해 수많은 무고한 유대인들을 학살한 나치 악마들의 혼란 뒤에는 사탄의 암흑물질이 숨겨져 있습니다.



지금 재생 중







The northern latitude coordinates of the Great Pyramid of Giza are known to be approximately \(29.9792458^). This number can be observed to correspond to the speed of light in a vacuum to 9 decimal places, starting with \(299,792,458m).

기자의 대 피라미드의 북위 좌표는 대략 \(29.9792458^)로 알려져 있습니다. 이 숫자는 \(299,792,458m)로 시작하여 진공 상태에서 빛의 속도에 해당하는 소수점 9자리까지 관찰할 수 있습니다.

i symbolizes the sun and moon floating on a pillar, which is the 9th number in the alphabet.


No matter how you slice it, the value can be 9.


This is mathematical proof that we are trapped in a cosmic prison ruled by Satan Lucifer, who controls cosmic matter.



earth


360 degrees = 3 + 6 + 0 = 9


180 degrees = 1 + 8 + 0 = 9


90 degrees = 9 + 0 = 9


45 degrees = 4 + 5 = 9


22.5 degrees = 2 + 2 + 5 = 9


11.25 degrees = 1 + 1 + 2 + 5 = 9


5.625 degrees = 5 + 6 + 2 + 5 = 18 = 1 + 8 = 9


2.8125 degrees


= 2 + 8 + 1 + 2 + 5 = 9


i는 알파벳 9번째 숫자인 기둥 위에 떠 있는 해와 달을 상징합니다.


어떻게 슬라이스하든 값은 9가 될 수 있습니다.


이는 우리가 우주 물질을 주관하는 사탄 루시퍼가 다스리는 우주 감옥에 갇혀 있다는 수학적 증거입니다.



지구


360도 = 3 + 6 + 0 = 9


180도 = 1 + 8 + 0 = 9


90도 = 9 + 0 = 9


45도 = 4 + 5 = 9


22.5도 = 2 + 2 + 5 = 9


11.25도 = 1 + 1 + 2 + 5 = 9


5.625도 = 5 + 6 + 2 + 5 = 18 = 1 + 8 = 9


2.8125도


= 2 + 8 + 1 + 2 + 5 = 9



The Illuminati numerology 13, symbolizing Satan Lucifer, is equal to 1/3, which is 0.3333333. This is why 33 is important to the Illuminati.


일루미나티 수비학에서 사탄 루시퍼를 상징하는 13은 1/3, 즉 0.3333333과 같습니다. 이것이 일루미나티에게 33이 중요한 이유입니다.

When calculating the merger ratio of Samsung C&T stocks and Cheil Industries stocks, several media outlets reported that Samsung C&T stocks are undervalued at 1/3 of Cheil Industries stocks.

삼성물산 주식과 제일모직 주식의 합병비율을 계산해 보면, 삼성물산 주식이 제일모직 주식의 1/3 수준으로 저평가돼 있다는 언론보도가 나왔다.

It is clear that 1/3 is between 0.3333 and 0.3334. 3 times 1/3 is 1, 3 times 0.3333 is 0.9999,

1/3은 0.3333과 0.3334 사이에 있는 것이 분명합니다. 1/3을 3번 곱하면 1이고, 0.3333을 3번 곱하면 0.9999입니다.




January 9, 2019 = Samsung Group Cheil Industries-YG Entertainment launch fashion brand Nonagon On January 9, 2019, just before the Burning Sun incident became serious, the collaboration suddenly ended. =

2+1+9+1+9

2019년 1월 9일 = 삼성그룹 제일모직-YG엔터테인먼트, 패션 브랜드 '노나곤' 론칭 2019년 1월 9일, 버닝썬 사태가 본격화되기 직전, 두 사람의 협업은 돌연 종료되었습니다. =

2+1+9+1+9




It's called Nonagon, and it's a shape (polygon) with nine sides and nine angles.

It's a word created by adding the prefix 'Nona-' meaning 9 to the suffix '-gon' meaning polygon.

It's called Enneagon, and you know that ennea is 9 in the Enneagram~~

It's a spherical shape.

If you connect all the corners of a spherical shape, it looks like the picture on the side.

There are nine muses in Greek mythology.

There are nine main gods in Egyptian mythology~.

In Korea, there is a legend about a fox with nine tails called the Gumiho.

구각(九角)이라고 하는데, 변이 9개, 각이 9개인 다각형입니다.

9를 뜻하는 접두사 '노나-'와 다각형을 뜻하는 접미사 '곤'을 붙여서 만든 단어입니다.

에니어그램에서 에니어는 9라는 것을 아시죠~~

구형이죠.

구형의 모든 모서리를 연결하면 옆면의 그림처럼 보입니다.

그리스 신화에는 9명의 뮤즈가 있습니다.

이집트 신화에는 9명의 주요 신이 있습니다~.

한국에는 구미호라고 불리는 꼬리가 9개 달린 여우에 대한 전설이 있습니다.





이 안에서 우리는 숨은 그림찾기를 해볼까요?








9 is a number that stands alone, but

9 and 3, and the repeated 3

There is a 3 hidden inside it. It's like a hidden ambition~

9는 홀로 존재하는 숫자지만,

9와 3, 그리고 반복되는 3은

그 안에 3이 숨겨져 있어요. 마치 숨겨진 야망 같아요~






In Christianity, Lucifer is often depicted as Satan masquerading as an angel of light. This is an interpretation that comes from Bible verses, especially 2 Corinthians 11:14: “For even Satan disguises himself as an angel of light.”




기독교에서는 루시퍼를 빛의 천사로 가장한 사탄으로 묘사하는 경우가 많습니다. 이것은 성경 구절, 특히 고린도후서 11장 14절에 나오는 해석입니다: “사탄도 자기를 빛의 천사로 가장하나니.”

Copper has the element symbol Cu and atomic number 29.

This is Hong Seok-hyeon, the owner of the cu convenience store. 



The Korean Air Flight 858 Itaewon disaster, the Jeju Air disaster, the crash of a Navy patrol plane, and the collision between a U.S. airliner and a military helicopter all occurred on the 29th.

It is believed to have been offered as a sacrifice to Satan Lucifer.


구리는 원소 기호 Cu와 원자 번호 29를 가지고 있습니다.

cu편의점 주인 홍석현 입니다. 



대한항공 858편 이태원 참사, 제주항공 참사, 해군 초계기 추락, 미 여객기와 군용 헬기 충돌 사고가 모두 29일 일어났다.

사탄 루시퍼에게 제물로 바쳐졌다고 믿어집니다.




동영상 설명,헬기 측에 여객기를 피하라고 지시하는 듯한 내용의 관제사의 음성



On the night of January 29 (local time), a passenger plane and a military helicopter collided in the air near Washington, D.C., USA. Those in the aviation industry who do not understand how such an incident could occur in what one expert described as "the most tightly controlled flight zone in the world" are those who do not think of hacking and remote control. And those who do not understand that the purpose of Satan's zombies is to sacrifice human sacrifices to Satan Lucifer.


1월 29일(현지시간) 밤 미국 워싱턴 D.C. 인근 상공에서 여객기와 군용 헬리콥터가 충돌했다. 한 전문가가 "세계에서 가장 엄격하게 통제되는 비행 구역"이라고 표현한 곳에서 어떻게 이런 사고가 발생할 수 있는지 이해하지 못하는 항공 업계 관계자들은 해킹이나 원격 조종을 생각하지 않는 사람들이다. 그리고 사탄의 좀비들의 목적이 사탄 루시퍼에게 인간 제물을 제물로 바치는 것임을 이해하지 못하는 자들.


In Christianity, Lucifer symbolizes Satan, who masquerades as a shining and good being on the outside, but is actually evil, based on the verse in 2 Corinthians 11:14, "Even Satan disguises himself as an angel of light." Since the name 'Lucifer' itself means 'one with light' in Latin, it is combined with the meaning of this verse and interpreted as a symbol representing the nature of Satan, who hides darkness and evil and disguises himself as a shining being to deceive people.


기독교에서 루시퍼는 고린도후서 11장 14절 “사탄도 자기를 빛의 천사로 가장하나니”라는 구절을 근거로 겉으로는 빛나고 선한 존재로 가장하지만 사실은 악한 사탄을 상징합니다. '루시퍼'라는 이름 자체가 라틴어로 '빛과 하나'라는 뜻이므로 이 구절의 의미와 결합되어 어둠과 악을 숨기고 빛나는 존재로 가장하여 사람들을 미혹하는 사탄의 본성을 나타내는 상징으로 해석된다.


The northern latitude coordinates of the Great Pyramid of Giza are known to be approximately \(29.9792458^). This number can be observed to correspond to the speed of light in a vacuum to 9 decimal places, starting with \(299,792,458m).

기자의 대 피라미드의 북위 좌표는 대략 \(29.9792458^)로 알려져 있습니다. 이 숫자는 \(299,792,458m)로 시작하여 진공 상태에서 빛의 속도에 해당하는 소수점 9자리까지 관찰할 수 있습니다.




The word "beast" appears a total of 36 times in the Book of Revelation, and 666 is the 36th triangular number, that is, the sum of all natural numbers from 1 to 36. Therefore, 666 can be said to be a triangular number among triangular numbers. 요한계시록에는 '짐승'이라는 단어가 총 36번 등장하는데, 666은 36번째 삼각수, 즉 1에서 36까지의 모든 자연수를 합한 수입니다. 따라서 666은 삼각수 중 삼각수라고 할 수 있습니다.


Trump shows a bruise on his right hand

오른손에 멍자국이 보이는 트럼프 

The word 'beast' appears 36 times in the Book of Revelation, and if you add this number from 1 to 36, you get 666. This claim is related to the number 666, which is the number 6 (a symbol of imperfection, negativity) repeated six times, and is interpreted to symbolize the evil forces described in Revelation 13, namely the Antichrist and the false prophet.


요한계시록에는 짐승이라는 단어가 36번 나오며, 1부터 36까지 이 숫자를 더하면 666이 된다. 이 주장은 6번(불완전함, 부정의 상징)이 6번 반복되는 숫자 666과 관련이 있으며, 요한계시록 13장에 나오는 악의 세력, 즉 적그리스도와 거짓 선지자를 상징하는 것으로 해석된다.


It is no coincidence that the sixth prime number in the Satanic Beast hierarchy program is 13. In this way, the number 13 symbolizes the attributes of the snake and red dragon of the Antichrist, who oppose God's work of creation and salvation. Illuminati Numerology 13 is an important number symbolizing the Satanic Serpent and the Red Dragon.


사탄짐승의 서열 프로그램에서 여섯 번째 소수가 13인 것은 우연이 아니다. 이처럼 13이라는 숫자는 하나님의 창조와 구원의 역사를 반대하는 적그리스도의 뱀과 붉은 용의 속성을 상징한다. 일루미나티 수비학 13은 사탄의 뱀과 붉은 용을 상징하는 중요한 숫자입니다.



The angle of rotation during one cycle of precession is 360 degrees. Precession refers to the phenomenon in which the axis of rotation of a rotating object rotates in a cone shape around another axis. At this time, the time it takes for the rotation axis to rotate once is one cycle, and during this one cycle, the rotation axis rotates 360 degrees.

세차 운동의 한 주기 동안 회전 각도는 360도입니다. 세차운동이란 회전하는 물체의 회전축이 다른 축을 중심으로 원뿔 모양으로 회전하는 현상을 말합니다. 이때, 회전축이 1회전하는데 걸리는 시간은 1사이클이고, 이 1사이클 동안 회전축은 360도 회전하게 된다.

Rotate 360 degrees as the Earth rotates once a day

지구가 하루에 한 번 자전하면서 360도 회전합니다.

The twisted shape of DNA shows ‘rotational symmetry’. Even if you turn it 360 degrees, the same pattern repeats itself.

DNA의 뒤틀린 모양은 '회전대칭'을 나타냅니다. 360도 돌려봐도 같은 패턴이 반복됩니다.


The helical structure of DNA is a mathematically perfect geometric shape. This is called a ‘double helix’. 

The angles and spacing of this spiral are also very precise. Rotates approximately 36 degrees per rotation


DNA의 나선형 구조는 수학적으로 완벽한 기하학적 모양입니다. 이를 '이중 나선'이라고 합니다. 

이 나선의 각도와 간격도 매우 정확합니다. 1회전당 약 36도 회전



Your description of the Pyramids of Giza, Egypt is correct. The Giza Pyramids are located approximately 13 km from downtown Cairo. The entrance is twisted 3.6 degrees to the northeast and is located 13 stories high.


이집트 기자 피라미드에 대한 귀하의 설명이 정확합니다. 기자 피라미드는 카이로 시내에서 약 13km 떨어져 있습니다. 입구는 북동쪽으로 3.6도 비틀어져 있으며 높이는 13층이다.





The word "beast" appears a total of 36 times in the Book of Revelation, and the number 666 is widely interpreted to symbolize Satan. In particular, the description of beasts appears intensively in Chapter 13.





요한계시록에는 짐승이라는 단어가 총 36번 나오며, 666이라는 숫자는 사탄을 상징하는 것으로 널리 해석된다. 특히 13장에는 짐승에 대한 묘사가 집중적으로 등장한다.





 Precessing Black Hole 또는 Black Hole Precession



Human sperm use precession, in which their body axes rotate together to offset the asymmetrical movement of their tails, allowing them to move toward the egg in a linear, rather than circular, motion.

인간 정자는 꼬리의 비대칭 움직임을 상쇄하기 위해 신체 축이 함께 회전하는 세차 운동을 사용하여 원형이 아닌 선형 운동으로 난자를 향해 이동할 수 있습니다.


Precession of atoms or electrons refers to a phenomenon in which the magnetic moment of a particle is tilted in an external magnetic field and rotates like a top around the direction of the external magnetic field.

원자나 전자의 세차운동은 입자의 자기모멘트가 외부 자기장에 의해 기울어지고, 외부 자기장의 방향을 중심으로 팽이처럼 회전하는 현상을 말한다.




지구의 자전축처럼 세차 운동을 하고 있는 우리 은하.


Our galaxy is undergoing precession like the Earth's axis of rotation.


Just as the hypothetical existence of an unobserved planet was introduced to explain errors in the precession of Mercury's perihelion, dark matter is a hypothetical substance introduced to explain inconsistencies in the explanation of the rotation speed of galaxies or the formation of the structure of the universe. In other words, the existence of dark matter is assumed to explain the differences between current laws of physics and what is observed in phenomena related to gravity, such as precession.


수성의 근일점 운동 오류를 설명하기 위해 관측되지 않은 행성의 가상 존재가 도입된 것처럼, 암흑물질은 은하의 회전 속도나 우주 구조 형성에 대한 설명의 불일치를 설명하기 위해 도입된 가상의 물질이다. 즉, 암흑물질의 존재는 현행 물리법칙과 세차운동 등 중력과 관련된 현상에서 관찰되는 차이를 설명하는 것으로 가정된다.


Let’s briefly understand the principles of MRI. Humans make up about 60% of their body weight in water. Water is made up of hydrogen and oxygen atoms. Among these, the nucleus of the hydrogen atom is a proton, and it has spin, which gives it magnetic properties. Medical equipment that takes MRI pictures has a magnet that creates a strong magnetic field. When a person enters the magnetic field, the magnetic spin of the hydrogen nucleus in our body aligns in the direction of the magnetic field. Magnetic spindles aligned side by side precess at a specific frequency, and the frequency of the precession varies depending on the size of the magnetic field where each hydrogen atom is located and its surrounding environment. In this situation, when an electromagnetic wave of the same frequency as the precession frequency is applied from the outside, the magnet spin causes a resonance phenomenon to absorb or emit the energy of the electromagnetic wave coming from the outside. Magnetic resonance imaging measures the absorption and emission patterns of this energy and reconstructs them with a computer. To put it simply, a picture taken by an MRI can be said to be an image that measures the magnetic resonance distribution of hydrogen nuclei precessing in a magnetic field.

MRI의 원리를 간단히 알아보자.

사람은 체중의 약 60퍼센트가 물이다. 물은 수소와 산소 원자로 이루어져 있다. 이 중 수소 원자의 원자핵은 양성자인데, 스핀을 갖고 있어 자석의 성질을 띤다. MRI 사진을 찍는 의료장비에는 강한 자기장을 만들어 내는 자석이 있다. 그 자기장 안에 사람이 들어가면, 우리 몸 속 수소 원자핵의 자석 스핀이 자기장 방향으로 정렬한다. 나란히 정렬된 자석 스핀들은 특정 주파수로 세차운동을 하는데, 세차운동의 주파수는 각 수소 원자가 위치한 부위의 자기장 크기와 그 주변 환경에 따라 달라진다. 이런 상황에서 세차운동의 주파수와 같은 주파수의 전자기파를 외부에서 가하면, 자석 스핀은 공명현상을 일으켜 외부에서 들어온 전자기파의 에너지를 흡수하거나 방출한다. 자기공명영상은 이런 에너지의 흡수와 방출 패턴을 측정하여 컴퓨터로 재구성한 것이다.

간단히 정리하면, MRI에 찍힌 사진이란, 자기장 속에서 세차운동을 하는 수소 원자핵의 자기공명 분포를 측정한 이미지라고 할 수 있다.


2 Corinthians <11:14> Even the devil Lucifer disguises himself as an angel of light.

고린도후서 <11:14> 마귀 루시퍼도 자기를 빛의 천사로 가장합니다.









This blogger's judgment is that Korea's No. 1 Illuminati devil parasite Hong Seok-hyun and devil cockroach Lee Jae-yong, chairman of Samsung Electronics, elected Lee Jae-myung through a fraudulent election and made him go through the Illuminati approval process (coronation ceremony) through the 'Appointment Ceremony of Light' held this time.


본 블로거의 판단은 대한민국 1위 일루미나티 악마기생충 홍석현과 악마바퀴벌레 이재용 삼성전자 회장이 부정선거로 이재명을 선출하고 이번에 열린 '빛의 임명식'을 통해 일루미나티 승인절차(대관식)를 거치게 했다는 것이다.


Lee Jae-myung could not overcome the judicial risk of the court led by Cho Hee-dae and could have fallen by the wayside, but at a critical moment, Hong Seok-hyun (Samsung) Lee Jae-yong stepped in and eliminated the last judicial risk, allowing Lee Jae-myung to become president.



​이재명은 조희대가 이끄는 법원의 사법리스크를 이기지 못하고 낙오될 수도 있었지만, 결정적인 순간 홍석현(삼성) 이재용이 개입해 마지막 사법리스크를 제거해 이재명이 대통령이 될 수 있도록 했다.








The Illuminati Triad was formed at the Rockefeller Mansion on July 1, 1972, under the auspices of David Rockefeller (former CFR Chairman). Seok-Hyeon Hong: Served as Vice-Chairman of the Asia-Pacific Committee from 2012 to 2019. Samsung Electronics Dirty Devil Chairman Lee Jae-yong



일루미나티 삼합회는 1972년 7월 1일 록펠러 맨션에서 데이비드 록펠러(전 CFR 회장)의 후원으로 결성되었습니다. 홍석현 : 2012년부터 2019년까지 아시아태평양위원회 부의장을 역임했다. 삼성전자 더러운 악마 회장 이재용






 

In 1909, a person believed to be a black child is shown being tied up and moved for ritual.

Bohemian Grove Satan

As the Molexin ritual continued for a while, fire flew in front of the owl statue along with the devil's scream and it fell, Satan

The evil ritual of human sacrifice to Molexin reaches its peak. Photo: Alex Jones


1909년에는 흑인 어린이로 추정되는 사람이 묶여 의식을 위해 옮겨지는 모습이 등장합니다.


보헤미안 그로브 사탄


몰렉신 의식이 한동안 계속되자 악마의 비명과 함께 부엉이 조각상 앞으로 불이 날아와서 쓰러졌다, 사탄


몰렉신에게 인간을 제물로 바치는 사악한 의식이 정점에 달합니다. 사진: 알렉스 존스





Alex jones immediately exposed this on his show program, and of course, interest was proven through hundreds of thousands of views on YouTube. Alex Jones also surprises and interviews Republican Congressman David Gergen, an important person who participated in this, and embarrasses him. That's right. The Bohemian groove ritual that made the Republican Party leader so embarrassed that he even ran away in anger later on was part of the MOLECH faith that had been handed down since ancient times. The MOLECH faith appears in the Old Testament of the Bible and was a very cruel custom in the Canaan region that involved sacrificing children to a god statue, setting it on fire, and letting it fall into the flames.

The Trilateral Society was organized at the Rockefeller Mansion on July 1, 1972, under the patronage of David Rockefeller (former CFR president). Seok-Hyeon Hong: He served as vice-chairman of the Asia-Pacific Committee from 2012 to 2019. Samsung Electronics Devil member Chairman Lee Jae-yong

Photo Caption: History of the Sambyeonhoe Logo


알렉스 존스는 자신의 쇼 프로그램에서 이를 즉각 폭로했고, 당연히 유튜브 조회수 수십만 건을 통해 관심이 입증됐다. 알렉스 존스도 이에 참여한 중요한 인물인 공화당 의원 데이비드 거겐을 깜짝 인터뷰해 그를 당황하게 한다. 좋아요. 공화당 원내대표가 나중에 화를 내며 도망칠 정도로 당황하게 만든 보헤미안 그루브 의식은 고대부터 이어져 온 몰렉 신앙의 일부였다. 몰렉 신앙은 구약성경에 나오는데, 가나안 지역에서 신상에 어린 아이를 제물로 바쳐 불을 지르고 불에 던져버리는 매우 잔혹한 풍습이었습니다.


삼극 협회는 David Rockefeller(전 CFR 회장)의 후원으로 1972년 7월 1일 Rockefeller Mansion에서 조직되었습니다. 홍석현 : 2012년부터 2019년까지 아시아태평양위원회 부의장을 역임했다. 삼성전자 데블 멤버 이재용 회장


사진설명: 삼변회 로고의 역사


 




You need to know about the Trilateral Commission. The abbreviation for the Triangular Committee is called Sambyeonhoe. The English spelling is ‘Trilateral Commission’. This organization was founded by David Rockefeller (President of Chase Manhattan Bank), the youngest of the four Rockefeller brothers, a member of the Illuminati, and was formed by members of the American, Japanese, and European parliaments, business community, academia, and media. Just as you can see the number 666 on the Rockefeller Building in New York, Rockefeller used 666 as the logo (mark) of the Trilateral Committee in the early days.

 

However, as controversy arose in some quarters, the number 666 was slightly modified and the current logo (666) was used. Even today, the Rockefeller Building has a neon sign with the number 666.

The triangular committee consists of the European Group, North American Group, and Pacific Asia Group. There is a Pacific Asia Group, and Samsung Electronics Chairman Lee Jae-yong is also a member.

An owl was used in the logo of Family Express, operated by JoongAng Ilbo. The owl is the logo of Bohemian Grove and a symbol of Molexin, the symbol of Satan's human sacrifice. In the case of Samsung, there are places where pyramids are built.


삼자위원회에 대해 알아야합니다. 삼각위원회의 약칭은 삼변회이다. 영문 철자는 'Tritral Commission'이다. 이 조직은 일루미나티 회원이자 록펠러 4형제 중 막내인 데이비드 록펠러(체이스맨해튼은행 총재)가 창설한 단체로, 미국, 일본, 유럽 의회, 재계, 학계, 언론계 인사들이 모여 결성했다. 뉴욕의 록펠러 빌딩에서 666이라는 숫자를 볼 수 있듯이 록펠러는 초기에 삼극위원회의 로고(마크)로 666을 사용했습니다.


 


그러나 일각에서 논란이 일자 666이라는 숫자를 약간 수정해 현재의 로고(666)를 사용하게 됐다. 오늘날에도 록펠러 빌딩에는 666이라는 숫자의 네온사인이 있습니다.


삼각위원회는 유럽그룹, 북미그룹, 태평양아시아그룹으로 구성된다. 퍼시픽아시아그룹이 있고, 이재용 삼성전자 회장도 회원이다.


중앙일보에서 운영하는 패밀리익스프레스의 로고에 부엉이를 사용하였습니다. 부엉이는 보헤미안 그로브의 로고이자 사탄의 인간 희생의 상징인 몰렉신의 상징입니다. 삼성의 경우 피라미드를 쌓는 곳이 있다.






Meeting of pro-Moon Jae-in core forces The group name is ‘Owl’.

친문재인 핵심세력 모임 그룹명은 '부엉이'.





The 'owl group' protecting Moon Jae-in is causing controversy.


Source: Media Today (https://www.mediatoday.co.kr)






In 1994, Hong Seok-hyun, vice president and CEO of JoongAng Ilbo, took office. He was promoted to president in March of the following year, and became chairman of JoongAng Ilbo in 1999.

 

문재인을 보호하는 '부엉이 집단'이 논란을 일으키고 있다.


출처 : 미디어투데이(https://www.mediatoday.co.kr)






1994년 홍석현 중앙일보 대표이사 부사장이 취임했다. 이듬해 3월 사장으로 승진했고, 1999년 중앙일보 회장이 됐다.






 The second law of thermodynamics states that all changes that occur in the material world of the universe, which is dominated by Satan, Lucifer, and dark matter, which account for 85% of the mass of the universe, occur in the direction of increasing entropy by making the universe more disorderly. The evidence is that when humans grow old, they die due to the increase in disordered entropy.


열역학 제2법칙은 우주 질량의 85%를 차지하는 사탄, 루시퍼, 암흑물질이 지배하는 우주의 물질세계에서 일어나는 모든 변화는 우주를 더욱 무질서하게 만들어 엔트로피가 증가하는 방향으로 일어난다는 것이다. 증거는 인간이 늙으면 무질서한 엔트로피의 증가로 인해 죽는다는 것입니다.


The second law of thermodynamics states that all changes that occur in the material world of the universe, dominated by Satan, Lucifer, and dark matter, which account for 85% of the universe's mass, occur in the direction of increasing entropy by making the universe more disordered.

This is similar to the phenomenon in which living things use energy to reduce entropy, but the difference is that both air conditioners and living things require external manipulation. The probability of something occurring naturally on its own can be considered very low.


열역학 제2법칙은 우주 질량의 85%를 차지하는 사탄, 루시퍼, 암흑물질이 지배하는 우주의 물질세계에서 일어나는 모든 변화는 우주를 더욱 무질서하게 만들어 엔트로피가 증가하는 방향으로 일어난다는 것이다.

이는 생명체가 에너지를 사용해 엔트로피를 낮추는 현상과 유사하지만, 에어컨과 생명체 모두 외부 조작이 필요하다는 점에서 차이점이 있다. 자연적으로 어떤 일이 저절로 일어날 확률은 매우 낮은 것으로 간주될 수 있습니다.




The increase in life, especially humans, causes an overall increase in entropy along with increased carbon dioxide emissions. Living things maintain an orderly state by absorbing energy from the outside, but from an overall perspective, this does not cancel out the increase in entropy, but rather accelerates it.


The purpose of the Illuminati forces' plan to reduce population is to reduce the disorderly increase of entropy.



<2024 파리 올림픽선수촌은 친환경 올림픽을 만들기 위해 에어컨을 갖추지 않았습니다. 대신 건물 배치와 지하수를 활용한 냉각 시스템으로 실내 온도를 외부보다 낮게 유지한다고 한다.> 

이런 뉴스를 보는 한국인들은 이해하지 못한다.


Many materialistic Koreans don't understand why they don't use air conditioning in the hot summer.


많은 물질주의적인 한국인들은 더운 여름에 왜 에어컨을 사용하지 않는지 이해하지 못합니다.


Korea maintains a comfortable indoor environment by using air conditioners even during heat waves, but it is argued that this is not environmentally friendly as it causes an increase in overall entropy. On the other hand, Paris is making efforts to reduce carbon emissions and alleviate the urban heat island effect by introducing a cooling system using the Seine River instead of air conditioning.

한국은  폭염 속에서도 에어컨을 사용하여 쾌적한 실내 환경을 유지하지만, 이는 전체 엔트로피를 증가시켜 환경친화적이지 않다는 주장이 제기되고 있다. 한편, 파리는 에어컨 대신 센강을 활용한 냉각 시스템을 도입해 탄소 배출을 줄이고 도시 열섬 현상을 완화하기 위해 노력하고 있다.


In Korea, the heat wave is getting more and more severe to the point that summer is scary, but the heat and humidity in Paris, France are lower than in Korea, so the heat wave is not as severe as in Korea. When you turn on the air conditioner, it gets cooler inside and the orderly entropy decreases, but it gets hotter outside and the overall disorderly entropy increases, so most Koreans do not have the intelligence to understand that it is not environmentally friendly.


한국은 여름이 무섭게 느껴질 정도로 폭염이 점점 심해지고 있지만, 프랑스 파리의 더위와 습도가 한국보다 낮아 폭염이 한국만큼 심하지는 않습니다. 에어컨을 켜면 실내는 더 시원해지고 질서 엔트로피는 감소하지만, 바깥은 더 뜨거워지고 전체적인 무질서 엔트로피가 증가하기 때문에 대부분의 한국인들은 환경 친화적이지 않다는 것을 이해할 지능이 없습니다.


High humidity can contribute to increased entropy because it increases the amount of water vapor molecules in the air, increasing the disorder of the system. High humidity prevents sweat from evaporating and creates a sticky feeling, which can cause discomfort and amplify health problems and stress.


높은 습도는 공기 중의 수증기 분자 양을 증가시켜 시스템의 무질서를 증가시키기 때문에 엔트로피 증가에 기여할 수 있습니다. 습도가 높으면 땀이 증발하는 것을 막아 끈적끈적한 느낌을 만들어 불편함을 유발하고 건강 문제와 스트레스를 증폭시킬 수 있습니다.


The development of technologies for controlling humidity and removing carbon dioxide and radiation is very important for creating a comfortable environment, increasing energy efficiency, and human survival. In particular, innovative research in the field of architecture and technology is urgently needed. Humidity, carbon dioxide, and radiation all have a negative impact on the environment by increasing entropy, so developing technology to effectively remove them is an essential task for survival.


습도 조절, 이산화탄소 및 방사선 제거 기술의 개발은 쾌적한 환경 조성, 에너지 효율 증대, 인류 생존을 위해 매우 중요합니다. 특히 건축과 기술 분야의 혁신적인 연구가 시급히 필요하다. 습도, 이산화탄소, 방사선 등은 모두 엔트로피를 증가시켜 환경에 부정적인 영향을 미치므로 이를 효과적으로 제거하는 기술 개발은 생존을 위한 필수 과제이다.


The increase in life, especially humans, causes an overall increase in entropy along with increased carbon dioxide emissions. Living things maintain an orderly state by absorbing energy from the outside, but from an overall perspective, this does not cancel out the increase in entropy, but rather accelerates it.


The purpose of the Illuminati forces' plan to reduce population is to reduce the disorderly increase of entropy.


생명, 특히 인간의 증가는 이산화탄소 배출 증가와 함께 전반적인 엔트로피 증가를 유발합니다. 생명체는 외부로부터 에너지를 흡수하여 질서 있는 상태를 유지하지만, 전체적인 관점에서 볼 때 이는 엔트로피 증가를 상쇄하는 것이 아니라 오히려 가속시킨다.


일루미나티 세력의 인구 감소 계획의 목적은 무질서한 엔트로피 증가를 줄이는 것입니다.


The increase in life, especially humans, causes an overall increase in entropy along with increased carbon dioxide emissions. Living things maintain an orderly state by absorbing energy from the outside, but from an overall perspective, this does not offset the increase in entropy, but rather accelerates it.




생명, 특히 인간의 증가는 이산화탄소 배출 증가와 함께 전반적인 엔트로피 증가를 유발합니다. 생명체는 외부로부터 에너지를 흡수하여 질서 있는 상태를 유지하지만, 전체적인 관점에서 볼 때 이는 엔트로피 증가를 상쇄하는 것이 아니라 오히려 가속시킨다.




If you write Crown, Virus, 19 in English, it becomes Crown Virus Nineteen, and if you write it in English gematria, it becomes 1488.




And this means that English words such as coronavirus, President Donald Trump, and abomination of vanity each have the same number in the English gematria 1488.


Crown, Virus, 19를 영어로 쓰면 Crown Virus Nineteen이 되고, 영어 gematria로 쓰면 1488이 됩니다.




그리고 이는 코로나바이러스(coronavirus), 도널드 트럼프 대통령(President Donald Trump), 혐오스러운 허영심(aabomination of vanity) 등의 영어 단어가 각각 영어 게마트리아 1488에서 동일한 숫자를 갖는다는 것을 의미한다.


In other words, the coronavirus broke out when Donald Trump was president, and it is a crown-like virus,19 so it appeared in 2019.

This is the abomination of destruction predicted by Daniel.


즉, 코로나바이러스는 도널드 트럼프가 대통령이었을 때 발생했고, 왕관 같은 바이러스이므로19 2019년에 나타났습니다.

이것이 다니엘이 예언한 멸망의 가증한 일입니다.


이 때에 인구 감소가 온다.
Population Reduction(인구 감소) = 1488

December Twenty Nineteen(12월 20 19) = 1488
2019년 12월에 나타난다.
코로나 바이러스는 2019년 12월 중국 우한에서 최초로 발병했다.

However, what now claims to be the God of Jesus Christ through Gematria is not the God of Jesus Christ, but the dark matter of Satan Lucifer, who controls the material of the world. 

In Revelation 13:17 there is a beast 666 with seven heads and ten horns, and the seven heads are full of blasphemy names.
Chapter 13 of the Book of Revelation tells us what the number of the beast means and tells us to interpret that number as the word 'wisdom'.

그러나 지금 게마트리아를 통해 예수 그리스도의 하나님이라고 주장하는 것은 예수 그리스도의 하나님이 아니라 세상의 물질을 조종하는 사탄 루시퍼의 암흑물질이다. 

요한계시록 13장 17절에는 일곱 머리와 열 뿔 가진 짐승 666이 있는데 그 일곱 머리에는 참람된 이름들이 가득하더라.
요한계시록 13장에는 짐승의 수가 무엇을 뜻하는지 알려주고, 그 수를 '지혜'라는 단어로 해석하라고 합니다.

In Chapter 10 of Revelation, seven lightning bolts roar in the sky and a voice is heard.
God said to the apostle John: “Wait! Don’t write down that voice! Seal it away!”

But they don't tell us why they ordered it to be sealed.

Perhaps 1488... 1488 was written on the monster's head, words that could be calculated as 1488 in English Gematria.

That word is...,

요한계시록 10장에는 일곱 개의 번개가 하늘에 울부짖고 음성이 들립니다.
하느님께서는 사도 요한에게 “잠깐만요! 그 소리를 기록하지 말고 봉인해 두십시오!”라고 말씀하셨습니다.

하지만 왜 봉인하라고 명령했는지는 알려주지 않습니다.

아마도 1488... 1488이 괴물의 머리에 적혀 있었는데, 영어 게마트리아에서는 1488로 계산할 수 있는 단어였다.

그 말은...,
Hi Im God Whats Your Name = 1488
There is no way that John, who had a vision of this beast between 68 and 70 AD, would have known the English alphabet that would appear long after his time.
So even if I wanted to, I couldn’t write it down.




And finally...,

'Your Life Was Scripted'
Is 

It appears as 1488 in English gematria.

Script means script. It also re
안녕하세요, 저는 신입니다. 이름이 무엇인가요? = 1488
서기 68년에서 70년 사이에 이 짐승에 대한 환상을 본 요한이 그의 시대 이후에 오랫동안 등장하게 될 영어 알파벳을 알았을 리가 없습니다.
그래서 쓰고 싶어도 쓸 수 없었어요.




그리고 마침내...,

'당신의 인생은 대본에 기록되었습니다'
~이다 

영어 gematria에서는 1488로 나타난다.

스크립트는 스크립트를 의미합니다. 프로그래밍할 때 소스 코드를 참조하기도 합니다.fers to source code when programming.



Lee Jae-myung's installation ceremony of light, coronation ceremony of the Illuminati

이재명의 빛 설치식, 일루미나티 대관식





The numbers 666 and 888 and the cube symbolizing Saturn

숫자 666과 888 그리고 Saturn의 상징인 큐브


In the Hankyoreh article introducing this, “The National Appointment Ceremony was an event in the nature of replacing the inauguration ceremony, which was omitted as the government was launched immediately after the early presidential election, and was held 71 days after the inauguration on June 4th.” If you calculate the number that appeared in the article titled ‘71 days after the inauguration on June 4th’ using Illuminati numerology, It comes out as 666 (6+4+7+1=18=6+6+6=666).


이를 소개하는 한겨례 기사에서 “국민임명식은 조기 대선 직후 정부가 곧바로 출범함에 따라 생략한 취임식을 대신하는 성격의 행사로, 지난 6월4일 취임 후 71일 만에 치러졌다.”라는 내용이 눈에 들어오는데, ‘6월 4일 취임 후 71일’이라는 기사 내용에 등장한 숫자를 일루미나티 수비학으로 계산하면 666(6+4+7+1=18=6+6+6=666)이 나온다.


The highlight of the event was a performance in which 80 citizen representatives displayed 80 appointment letters on a cube erected in the center of the stage to celebrate the 80th anniversary of liberation. As subscribers to the blog will be well aware, the cube, which is a cube, is another symbol of the Illuminati that imitates the New Jerusalem described in the Bible and represents Saturn, also known as ‘Satan’s Star.’

행사의 하이라이트엔 광복 80주년을 맞이하여 80명의 시민 대표가 무대 중앙에 세워놓은 큐브에다 80개의 임명장을 전시하는 퍼포먼스를 벌였는데, 블로그의 구독자라면 잘 알고 있겠지만, 정육면체인 큐브는 성경에 묘사하고 있는 신천신지 새예루살렘성을 모방한 일루미나티의 또 다른 상징으로 ‘사탄의 별’로도 알려진 Saturn(토성)을 의미한다.




















국민 임명식에 등장한 큐브와 이를 홍보하는 영상과 포스터

The number 888 appears.

​숫자 888이 나타납니다.


The coronavirus appeared in December 2019 and its official name is covid-19. '19'!!! Pay attention to the number 19! If you write crown, virus, and 19 in English, it is Crown Virus Nineteen, and this is the number 1488 in English gematria. And this means that the English words such as coronavirus outbreak, President Donald Trump, and the abomination of desolation each have the same number in English gematria, 1488. It comes out.


코로나바이러스는 2019년 12월에 나타났으며 공식 명칭은 covid-19입니다.

'19'!!!

숫자 19에 주목하세요!


Crown, Virus, 19를 영어로 쓰면 Crown Virus Nineteen이고, 영어 gematria에서는 1488이라는 숫자입니다.


그리고 이는 corona 바이러스 발발, 도널드 트럼프 대통령, 황폐의 가증한 것과 같은 영어 단어가 영어 게마트리아 1488에서 각각 동일한 숫자를 갖는다는 것을 의미한다.

나온다.



Coronavirus Outbreak 코로나 바이러스 발생 = 1488



abomination of desolation 멸망의 가증한 것 = 1488


president donald trump 대통령 도널드 트럼프 = 1488


'Crown Virus Nineteen' (왕관 바이러스 19) = 1488



Population Reduction(인구 감소) = 1488


December Twenty Nineteen(12월 2019) = 1488


Cant Stump The Trump(트럼프를 그루터기로 만들 수 없다) = 1488



'Your Life Was Scripted 당신의 인생은 스크립트로 작성되었습니다)'= 1488


킹제임스성경 마태 복음 24:15

그러므로 너희가 선지자 다니엘을 통하여 말씀하신 멸망의 가증한 것이 거룩한 곳에 선 것을 보리니, (읽는 자는 깨달으라.) When ye therefore shall see the abomination of desolation, spoken of by Daniel the prophet, stand in the holy place, (whoso readeth, let him understand:)


킹제임스성경 마르코 복음 13:14

그러나 너희가 선지자 다니엘이 말했던 멸망의 가증한 것이 서지 못할 곳에 서 있는 것을 볼 때면 (읽는 자는 깨달으라.) 유대에 있는 자들은 산으로 도망하라. But when ye shall see the abomination of desolation, spoken of by Daniel the prophet, standing where it ought not, (let him that readeth understand,) then let them that be in Judaea flee to the mountains:



The abomination of desolation will appear when Donald Trump is president.


At this time, the coronavirus occurs


It can be inferred from English Gematria numerology.




'Crown Virus Nineteen' also has the number 1488.


Corona The etymology of Corona is ‘crown’.

황폐의 가증한 것은 도널드 트럼프가 대통령이 되면 나타날 것입니다.


이때 코로나바이러스가 발생하여


이는 영어 게마트리아 수비학에서 추론할 수 있습니다.




'크라운바이러스 나인틴'에도 번호는 1488이다.


코로나 코로나(Corona)의 어원은 '왕관'이다.




The ‘Appointment Ceremony of Light’ held at Gwanghwamun Square to celebrate Liberation Day could easily be called the coronation ceremony of the Illuminati, also known as the Gwangmyeonghoe. If you look at the video below at 12 minutes and 51 seconds showing the process of this event, President Lee Jae-myung, who received the Appointment Ceremony of Light on the all-eye stage, is seen behind the scenes as strong as the sunlight. You can see him giving his impressions while the light shines on him.


광복절(光復節)을 맞아 광화문(光化門) 광장에서 열린 ‘빛의 임명식’은 광명회(光明會)로 불리는 일루미나티의 대관식으로 불러도 손색이 없을 것 같은데, 이 행사가 진행되는 과정을 보여주는 아래 영상 12분 51초를 보면 전시안 무대에서 빛의 임명장을 받은 이재명 대통령이 뒤에서 태양빛과 같이 강한 빛이 비추는 가운데 소감을 발표하는 모습을 볼 수 있다.








This blogger's judgment is that Korea's No. 1 Illuminati devil parasite Hong Seok-hyun and devil cockroach Lee Jae-yong, chairman of Samsung Electronics, elected Lee Jae-myung through a fraudulent election and made him go through the Illuminati approval process (coronation ceremony) through the 'Appointment Ceremony of Light' held this time.


본 블로거의 판단은 대한민국 1위 일루미나티 악마기생충 홍석현과 악마바퀴벌레 이재용 삼성전자 회장이 부정선거로 이재명을 선출하고 이번에 열린 '빛의 임명식'을 통해 일루미나티 승인절차(대관식)를 거치게 했다는 것이다.


Lee Jae-myung could not overcome the judicial risk of the court led by Cho Hee-dae and could have fallen by the wayside, but at a critical moment, Hong Seok-hyun (Samsung) Lee Jae-yong stepped in and eliminated the last judicial risk, allowing Lee Jae-myung to become president.



​이재명은 조희대가 이끄는 법원의 사법리스크를 이기지 못하고 낙오될 수도 있었지만, 결정적인 순간 홍석현(삼성) 이재용이 개입해 마지막 사법리스크를 제거해 이재명이 대통령이 될 수 있도록 했다.





2 Corinthians <11:14> Even the devil Lucifer disguises himself as an angel of light.

고린도후서 <11:14> 마귀 루시퍼도 자기를 빛의 천사로 가장합니다.





Samsung Electronics Devil Chairman Lee Jae-yong and Zombie Democratic Party Representative Lee Jae-myung Meeting Date


March 20, 2025 = 2+2+5+3+2=14=1+4=5


삼성전자 악마 이재용 회장과 좀비 민주당 이재명 의원 회동 날짜


2025년 3월 20일 = 2+2+5+3+2=14=1+4=5

Satan Zombie Cockroach Chinese Communist Party Flag has 4 small stars and 1 large star Satan Lucifer Evil Spirit Symbol

사탄 좀비 바퀴벌레 중국 공산당 깃발에는 작은 별 4개와 큰 별 1개가 있습니다. 사탄 루시퍼 악령 상징




<Illuminati Numerology 5> 4 elements (earth, air, water, fire) + Lucifer's light World ruled by Lucifer, total = 5 To the general public, the number 5 means death. But Satan's zombies symbolize blessing and protection. The changes in the movement of all things in the universe are based on the principle of energy, which is a basic and universal principle, and the four basic forces of nature known so far (strong nuclear force, weak nuclear force, and electromagnetic force). . . and gravity) 4 and +1 are caused by the action of only one force i.e. dark matter = satan lucifer the devil = 5 forces.

<일루미나티 수비학 5>

4원소(흙, 공기, 물, 불) + 루시퍼의 빛 루시퍼가 통치하는 세계, 합계 = 5 일반 대중에게 숫자 5는 죽음을 의미합니다. 하지만 사탄의 좀비들은 축복과 보호를 상징합니다.

우주 만물의 움직임의 변화는 기본적이고 보편적인 원리인 에너지의 원리와 지금까지 알려진 자연의 4가지 기본 힘(강핵력, 약한 핵력, 전자기력). . . 및 중력) 4와 +1은 단 하나의 힘, 즉 암흑 물질 = 사탄 루시퍼 악마 = 5개의 힘의 작용으로 인해 발생합니다.


2 Corinthians <11:14> Even the devil Lucifer disguises himself as an angel of light.

고린도후서 <11:14> 마귀 루시퍼도 자기를 빛의 천사로 가장합니다.



Satan Zombie Purchases Itaewon Land in Seoul in the Name of the Chinese Government 4162㎡ = 4 + 1 + 6 + 2 = 13 = 1 + 3 = 4

(Approximately 1256 pyeong) 1 + 2 + 5 + 6 = 14 = 1 + 4 = 5

Major Events in Korean Numerology Liberation Day 8.15 = 14 = 1 + 4 = 5

4.19 = 4 + 1 + 9 = 14 = 1 + 4 = 5

5.18 = 5 + 1 + 8 = 14 = 1 + 4 = 5

Yoon Seok-yeol Martial Law Army Memorial Day: December 3, 2024 = 14 = 5

Impeachment Bill Passes the National Assembly 14 days.

Singer Tani (real name Kim Jin-soo), who sang a song commemorating the Sewol ferry disaster, died in a car accident on the morning of April 14, 2018.



Among the Itaewon terrorist attacks, the foreign victims were from 14 countries.

The foreign victims of the Itaewon terrorist attacks were from 14 countries.

14=1+4=5

사탄 좀비, 중국 정부 명의로 서울 이태원 땅 매입 4162㎡ = 4 + 1 + 6 + 2 = 13 = 1 + 3 = 4

(약 1256평) 1 + 2 + 5 + 6 = 14 = 1 + 4 = 5

한국 수비학 주요 사건 광복절 8.15 = 14 = 1 + 4 = 5

4.19 = 4 + 1 + 9 = 14 = 1 + 4 = 5

5.18 = 5 + 1 + 8 = 14 = 1 + 4 = 5

윤석열 계엄군 현충일: 2024년 12월 3일 = 14 = 5

탄핵안 국회 통과 14일 만

세월호 참사를 추모하는 노래를 불렀던 가수 타니(본명 김진수)가 2018년 4월 14일 오전 교통사고로 사망했습니다.



이태원 테러 사건의 외국인 희생자는 14개국 출신이었습니다.

이태원 테러의 외국인 희생자는 14개국 출신이었습니다.

14=1+4=5



November 22, President Kennedy's assassination

11월 22일, 케네디 대통령 암살



 Samsung Group Chairman Lee Kun-hee's


 youngest daughter Lee Yoon-hyung (27


 years old) = 2 + 7 = 9 Funeral: November


 22, 2005

삼성그룹 이건희 회장의 막내딸 이윤형(27세) = 2 + 7 = 9 장례: 2005년 11월 22일




November 22, 2005 = 2+5+1+1+2+2=13th Luminati Numerology

2005년 11월 22일 = 2+5+1+1+2+2=13일루미나티 수비학 


Lee Yoon-hyung's Funeral Date November 22, 2005 = 2+5+1+1+2+2=13 Illuminati Numerology


Lee Yoon-hyung was 27 years old at the time =


2+5+1+1+2+2=13+2+7=22


Lee Jae-yong, the cunning devil who killed Lee Yoon-hyung by guessing the Illuminati Numerology, Samsung Electronics Chairman Lee Jae-yong

이윤형 장례일 2005년 11월 22일 = 2+5+1+1+2+2=13 일루미나티 수비학


이윤형은 당시 27세였습니다 =


2+5+1+1+2+2=13+2+7=22


이재용, 일루미나티 수비학을 맞혀 이윤형을 죽인 교활한 악마, 삼성전자 이재용 회장


November 19, 2005, 3:00 AM = 2+5+1+1+1+9+3=22 Lee Yoon-hyung, the youngest daughter of Samsung Group Chairman Lee Kun-hee. Two days later, she was cremated at a crematorium and offered as a sacrifice to the devil who leads the second beast.

2005년 11월 19일 오전 3시 = 2+5+1+1+1+9+3=22 삼성그룹 이건희 회장의 막내딸 이윤형. 이틀 후, 그녀는 화장터에서 화장되어 둘째 짐승을 이끄는 악마에게 제물로 바쳐졌습니다.





This 'Appointment Ceremony of Light' event, which features elaborate numerology and symbolism, can be seen as a ritual showing that the Illuminati of Hong Seok-hyun and Samsung Electronics Chairman Lee Jae-yong have elected Lee Jae-myung. If so, there are concerns about how far Lee Jae-myung's role will expand after an inauguration ceremony similar to the Illuminati coronation ceremony is held.



정교한 수비학과 상징성이 돋보이는 이번 '빛의 임명식' 행사는 홍석현 일루미나티와 이재용 삼성전자 회장이 이재명을 선출했음을 보여주는 의례라고 볼 수 있다. 그렇다면 일루미나티 대관식과 유사한 취임식이 거행된 이후 이재명의 역할이 어디까지 확장될지 우려가 나온다.


The divisors of 36 are 1, 2, 3, 4, 6, 9, 12, 18, and 36, and 36 is the 8th triangular number. Therefore, the numbers that are divisors of 36 and are trigonometric numbers are 1, 3, 6, and 36.

The word ‘beast’ appears 36 times in the Book of Revelation. And the ‘number of the beast’ mentioned in Revelation 13:18 is 666. These two are interconnected, which is further emphasized by the calculation that 6 x 6 = 36 and that the numbers 1 through 36 add up to 666.

36의 약수는 1, 2, 3, 4, 6, 9, 12, 18, 36이며, 36은 8번째 삼각수입니다. 따라서 36의 약수이면서 삼각수인 숫자는 1, 3, 6, 36입니다.

요한계시록에는 '짐승'이라는 단어가 36번 등장합니다. 그리고 요한계시록 13장 18절에서 언급되는 '짐승의 숫자'는 666입니다. 이 두 가지는 서로 연결되어 있으며, 6 x 6 = 36 이라는 계산과 1부터 36까지의 수를 모두 더하면 666이 된다는 점을 통해 더욱 강조됩니다.



The word "beast" appears a total of 36 times in the Book of Revelation, and 666 is the 36th triangular number, that is, the sum of all natural numbers from 1 to 36. Therefore, 666 can be said to be a triangular number among triangular numbers. 요한계시록에는 '짐승'이라는 단어가 총 36번 등장하는데, 666은 36번째 삼각수, 즉 1에서 36까지의 모든 자연수를 합한 수입니다. 따라서 666은 삼각수 중 삼각수라고 할 수 있습니다.


Trump shows a bruise on his right hand

오른손에 멍자국이 보이는 트럼프 

The word 'beast' appears 36 times in the Book of Revelation, and if you add this number from 1 to 36, you get 666. This claim is related to the number 666, which is the number 6 (a symbol of imperfection, negativity) repeated six times, and is interpreted to symbolize the evil forces described in Revelation 13, namely the Antichrist and the false prophet.


요한계시록에는 짐승이라는 단어가 36번 나오며, 1부터 36까지 이 숫자를 더하면 666이 된다. 이 주장은 6번(불완전함, 부정의 상징)이 6번 반복되는 숫자 666과 관련이 있으며, 요한계시록 13장에 나오는 악의 세력, 즉 적그리스도와 거짓 선지자를 상징하는 것으로 해석된다.


It is no coincidence that the sixth prime number in the Satanic Beast hierarchy program is 13. In this way, the number 13 symbolizes the attributes of the snake and red dragon of the Antichrist, who oppose God's work of creation and salvation. Illuminati Numerology 13 is an important number symbolizing the Satanic Serpent and the Red Dragon.


사탄짐승의 서열 프로그램에서 여섯 번째 소수가 13인 것은 우연이 아니다. 이처럼 13이라는 숫자는 하나님의 창조와 구원의 역사를 반대하는 적그리스도의 뱀과 붉은 용의 속성을 상징한다. 일루미나티 수비학 13은 사탄의 뱀과 붉은 용을 상징하는 중요한 숫자입니다.

The angle of rotation during one cycle of precession is 360 degrees. Precession refers to the phenomenon in which the axis of rotation of a rotating object rotates in a cone shape around another axis. At this time, the time it takes for the rotation axis to rotate once is one cycle, and during this one cycle, the rotation axis rotates 360 degrees.

세차 운동의 한 주기 동안 회전 각도는 360도입니다. 세차운동이란 회전하는 물체의 회전축이 다른 축을 중심으로 원뿔 모양으로 회전하는 현상을 말합니다. 이때, 회전축이 1회전하는데 걸리는 시간은 1사이클이고, 이 1사이클 동안 회전축은 360도 회전하게 된다.

Rotate 360 degrees as the Earth rotates once a day

지구가 하루에 한 번 자전하면서 360도 회전합니다.

The twisted shape of DNA shows ‘rotational symmetry’. Even if you turn it 360 degrees, the same pattern repeats itself.

DNA의 뒤틀린 모양은 '회전대칭'을 나타냅니다. 360도 돌려봐도 같은 패턴이 반복됩니다.


The helical structure of DNA is a mathematically perfect geometric shape. This is called a ‘double helix’. 

The angles and spacing of this spiral are also very precise. Rotates approximately 36 degrees per rotation


DNA의 나선형 구조는 수학적으로 완벽한 기하학적 모양입니다. 이를 '이중 나선'이라고 합니다. 

이 나선의 각도와 간격도 매우 정확합니다. 1회전당 약 36도 회전



Your description of the Pyramids of Giza, Egypt is correct. The Giza Pyramids are located approximately 13 km from downtown Cairo. The entrance is twisted 3.6 degrees to the northeast and is located 13 stories high.


이집트 기자 피라미드에 대한 귀하의 설명이 정확합니다. 기자 피라미드는 카이로 시내에서 약 13km 떨어져 있습니다. 입구는 북동쪽으로 3.6도 비틀어져 있으며 높이는 13층이다.





The word "beast" appears a total of 36 times in the Book of Revelation, and the number 666 is widely interpreted to symbolize Satan. In particular, the description of beasts appears intensively in Chapter 13.





요한계시록에는 짐승이라는 단어가 총 36번 나오며, 666이라는 숫자는 사탄을 상징하는 것으로 널리 해석된다. 특히 13장에는 짐승에 대한 묘사가 집중적으로 등장한다.


In Feng Shui, Ganbang (艮方) refers to the northeast (0 to 45 degrees) and is generally considered an inauspicious direction. 

The northeast direction of the Giza Pyramids is offset from Earth's true north by about 3.6 degrees. This means that the pyramids were not built to point exactly north. However, this does not necessarily mean that it is an error. It is possible that the ancient Egyptians did not base themselves on the exact North Pole, but used a different reference point.

풍수에서 간방(艮方)은 북동쪽(0~45도)을 말하며 일반적으로 불길한 방향으로 여겨진다. 

기자 피라미드의 북동쪽 방향은 지구의 진북에서 약 3.6도 오프셋되어 있습니다. 이는 피라미드가 정확히 북쪽을 향하도록 건설되지 않았음을 의미합니다. 그러나 이것이 반드시 오류임을 의미하는 것은 아닙니다. 고대 이집트인들은 정확한 북극을 기준으로 삼지 않고 다른 기준점을 사용했을 가능성이 있습니다

Satan Illuminati COVID-19 fraud A world where many people remain silent even if many people die due to Samsung Bio's MRNA vaccine

사탄 일루미나티 코로나19 사기 삼성바이오의 MRNA 백신으로 많은 사람이 죽어도 침묵하는 세상


















In psychoanalysis, it is widely accepted that human emotions and behavior 
are influenced by instinct, unconsciousness, and desires. In particular, Freud believed that unconscious desires and impulses greatly influence human behavior and emotions. This suggests that, similar to how dogs express dog instincts and emotions and pigs show pig-like behavior, humans are also influenced by the unconscious.

정신분석에서는 인간의 감정과 행동이 본능, 무의식, 욕망의 영향을 받는다는 것이 널리 받아들여지고 있습니다. 특히 프로이트는 무의식적인 욕망과 충동이 인간의 행동과 감정에 큰 영향을 미친다고 믿었습니다. 이는 개가 개의 본능과 감정을 표현하고, 돼지가 돼지와 같은 행동을 보이는 것과 마찬가지로 인간도 무의식의 영향을 받는다는 것을 시사한다.

There is almost no difference in performance between models like the iPhone 16 and models like the Galaxy S25, and the point is that lower animals are dominated by instinct and unconsciousness. 
Lower animals tend to be more governed by instinct and the unconscious. Instinct refers to basic behavioral patterns for survival and reproduction, and the unconscious influences human behavior in areas of which we are not conscious. Mating behavior is a representative example of being dominated by animal instincts and unconsciousness.

아이폰16 같은 모델과 갤럭시S25 같은 모델 간 성능 차이는 거의 없고, 하등동물은 본능과 무의식이 지배한다는 점이 포인트다. 
하등동물은 본능과 무의식의 지배를 더 많이 받는 경향이 있습니다. 본능은 생존과 번식을 위한 기본적인 행동 패턴을 말하며, 무의식은 우리가 의식하지 못하는 영역에서 인간의 행동에 영향을 미친다. 짝짓기 행위는 동물의 본능과 무의식이 지배하는 대표적인 예이다.







While analyzing human existence, Heidegger focused on emotions such as pure love, anxiety, and boredom. These emotions serve as a driving force that causes humans to constantly question their own existence and search for meaning. In other words, unlike instinctive animals, humans are beings who explore and reflect on the meaning of existence through conscious emotions rather than succumbing to the oppression of instinct and unconsciousness.


하이데거는 인간 존재를 분석하면서 순수한 사랑, 불안, 지루함과 같은 감정에 주목했다. 이러한 감정은 인간이 끊임없이 자신의 존재에 대해 의문을 품고 의미를 찾게 만드는 원동력이 된다. 즉 인간은 본능적인 동물과 달리 본능과 무의식의 억압에 굴복하지 않고 의식적인 감정을 통해 존재의 의미를 탐색하고 성찰하는 존재이다.


The ways in which Heidegger reveals the meaning of his way of being are feelings such as anxiety and boredom. These emotions are not simply emotions, but are interpreted as a conscious state that resists the instincts and unconsciousness that dominate the way of being.


하이데거가 자신의 존재 방식의 의미를 드러내는 방식은 불안, 지루함 등의 감정이다. 이러한 감정은 단순한 감정이 아니라, 존재 방식을 지배하는 본능과 무의식에 저항하는 의식적 상태로 해석된다.




Satan Lucifer Dark Matter The view that much (over 95%) of human behavior is driven by instinct and the unconscious, like dark matter making up 95% of the universe, is an interesting analogy. It's easy to think that humans act through rational thinking, but in reality, instinctive reactions and unconscious decisions account for a large part of our behavior.

사탄 루시퍼 암흑 물질 우주의 95%를 차지하는 암흑 물질처럼 인간 행동의 대부분(95% 이상)이 본능과 무의식에 의해 좌우된다는 견해는 흥미로운 비유입니다. 인간은 합리적 사고를 통해 행동한다고 생각하기 쉽지만, 실제로는 본능적인 반응과 무의식적인 결정이 우리 행동의 큰 부분을 차지합니다.


The distribution of dark matter within a galaxy cluster can be determined through gravitational lensing, where the higher the concentration of dark matter, the greater the degree of light bending.

은하단 내 암흑물질의 분포는 중력렌즈를 통해 확인할 수 있는데, 암흑물질의 농도가 높을수록 빛의 휘어짐 정도도 커집니다.

This is evidence that dark matter interacts gravitationally with normal matter. Gravity and entropy growth are fundamental in the evolution of the universe, and dark matter and dark energy play an important role in explaining these phenomena. It can be thought of in relation to scientific fact that as power and capital increase in human society, greed increases and can lead to a disorderly increase in entropy. Emotions and greed are influenced by animal instincts and unconsciousness.

이는 암흑물질이 정상물질과 중력적으로 상호작용한다는 증거이다. 중력과 엔트로피 성장은 우주 진화의 기본이며, 암흑물질과 암흑에너지는 이러한 현상을 설명하는 데 중요한 역할을 한다. 인간사회에서 권력과 자본이 증가할수록 탐욕도 증가하여 무질서한 엔트로피 증가를 초래할 수 있다는 것은 과학적 사실과 연관지어 생각해 볼 수 있다. 감정과 탐욕은 동물적 본능과 무의식의 영향을 받습니다.



Regardless of whether they have a lot of money or not, all humans have something in common in that they eventually die due to increased entropy as they age. Entropy increase is a physical law that explains the aging and death of living things as a natural process. It means that orderly life gradually becomes disordered over time, leading to death, and the Earth and the universe are also affected by the increase in entropy. There will be a clear difference in the entropy increase pattern between Seoul 50 years ago and Seoul now.

돈이 많든 적든 모든 인간은 나이가 들수록 엔트로피가 증가해 결국 죽는다는 공통점이 있다. 엔트로피 증가는 생명체의 노화와 죽음을 자연스러운 과정으로 설명하는 물리법칙이다. 질서정연한 삶이 시간이 지날수록 점차 흐트러져 죽음에 이르게 되고, 지구와 우주도 엔트로피의 증가에 영향을 받는다는 뜻이다. 50년 전 서울과 지금 서울의 엔트로피 증가 패턴에는 뚜렷한 차이가 있을 것이다.
In fact, the current concentration of carbon dioxide in the atmosphere is 420ppm, a 50% increase from before industrialization. Why is the city getting hotter? This is because of the concrete heat island trap.

실제로 현재 대기 중 이산화탄소 농도는 420ppm으로 산업화 이전보다 50% 증가했다. 도시는 왜 점점 더워지는 걸까요? 이는 콘크리트 열섬 트랩 때문이다.





The reason why Seoul's heat island effect is more severe than in American and European cities is because of its urban structure, air pollution, and insufficient eco-friendly policies. In particular, dense concrete buildings trap heat, and increased pollutants in the air accelerate urban warming, further aggravating the heat island effect. There are also claims that increased carbon dioxide increases entropy, which increases people's stress.

서울의 열섬효과가 미국이나 유럽의 도시보다 심각한 이유는 도시구조와 대기오염, 친환경 정책이 미흡하기 때문이다. 특히, 밀도가 높은 콘크리트 건물은 열을 가두어 대기 오염물질의 증가로 인해 도시 온난화가 가속화되어 열섬 현상이 더욱 심화됩니다. 이산화탄소 증가는 엔트로피를 증가시켜 사람들의 스트레스를 증가시킨다는 주장도 있습니다.

As carbon dioxide and entropy increase compared to 50 years ago, people's stress tends to increase. Stress can be seen as one of the factors that increases disordered entropy.

Simply put, compared to 50 years ago, the current increase in carbon dioxide in Seoul is related to the deepening of global warming and the increase in entropy disorders. This phenomenon may be related to the increase in entropy that causes the Earth and our planet, as well as increased human stress.
 
Humans grow old and die, and the universe becomes disordered over time and heads toward the end.
50년 전보다 이산화탄소와 엔트로피가 증가하면서 사람들의 스트레스도 늘어나는 경향이 있다. 스트레스는 무질서한 엔트로피를 증가시키는 요인 중 하나로 볼 수 있습니다.

간단히 말해서, 50년 전과 비교하면, 현재 서울의 이산화탄소 증가는 지구온난화 심화 및 엔트로피 장애 증가와 관련이 있습니다. 이러한 현상은 지구와 지구를 유발하는 엔트로피의 증가뿐만 아니라 인간의 스트레스 증가와도 관련이 있을 수 있습니다.
 
인간은 늙고 죽고, 시간이 지나면서 우주는 무질서해지며 종말을 향해 나아간다.

The explanation is correct about the effects of dark matter and gravity, which account for most of the mass of the universe, and human greed and stress on increasing entropy. Dark matter plays an important role in the gravitational functioning of the universe, and human greed and stress tend to increase entropy by increasing the disorder of physical systems. This is related to the second law of thermodynamics, which states that the entropy of an isolated system always increases.
우주 질량의 대부분을 차지하는 암흑물질과 중력, 인간의 탐욕과 스트레스가 엔트로피 증가에 미치는 영향에 대한 설명은 정확하다. 암흑물질은 우주의 중력작용에 중요한 역할을 하며, 인간의 탐욕과 스트레스는 물리계의 무질서를 증가시켜 엔트로피를 증가시키는 경향이 있다. 이는 고립계의 엔트로피는 항상 증가한다는 열역학 제2법칙과 관련이 있습니다.


Satan Lucifer's dark matter, which controls the matter of the world, can affect the mass and gravity of the universe and influence the disorder of the universe, or increase in entropy, which can predict future scenarios such as the thermal death (Big Rip) of the universe. The increase in disorder caused by human greed and the increase in entropy of the universe are both related to the increase in disorder, leading to human death and the end of the universe.

세상의 물질을 지배하는 사탄 루시퍼의 암흑물질은 우주의 질량과 중력에 영향을 주어 우주의 무질서에 영향을 미치거나, 엔트로피의 증가에 영향을 미쳐 우주의 열사(Big Rip) 등 미래 시나리오를 예측할 수 있다. 인간의 탐욕으로 인한 무질서의 증가와 우주의 엔트로피의 증가는 모두 무질서의 증가와 관련이 있으며, 이는 인간의 죽음과 우주의 종말로 이어진다.

John 10:10 says, “The thief (Satan) comes only to steal, kill, and destroy, but I have come so that they may have life and have it abundantly.” no see. This passage contrasts Jesus Christ with Satan to clearly demonstrate their purpose and role. Jesus came to give life, Satan comes to bring destruction and death


요한복음 10장 10절은 “도둑(사단)이 오는 것은 도적질하고 죽이고 멸망시키려는 것뿐이요 내가 온 것은 양으로 생명을 얻게 하고 풍성히 얻게 하려 함이라”고 말씀합니다. 아니 알겠습니다. 이 구절은 예수 그리스도를 사탄과 대조하여 그들의 목적과 역할을 분명하게 보여줍니다. 예수님은 생명을 주러 오셨고, 사탄은 멸망과 죽음을 가져오러 오셨습니다.



In the Bible, Satan is called 'the ruler of the power of the air'. Satan Dark matter symbolizes the mass, gravity, and material power of the universe, that is, the forces of sin and darkness. According to the second law of thermodynamics, the entropy of an isolated system always increases or remains constant, and never decreases. This explains why the arrow of time flows in only one direction, and represents the directionality in which time progresses from the past to the future. Einstein's statement that time and space are one can be understood by relating this increase in entropy to the direction of time.

성경에서는 사탄을 '공중의 권세 잡은 자'라고 부릅니다. 사탄 암흑물질은 우주의 질량, 중력, 물질적 힘, 즉 죄와 어둠의 세력을 상징합니다. 열역학 제2법칙에 따르면 고립계의 엔트로피는 항상 증가하거나 일정하게 유지되며 결코 감소하지 않습니다. 이는 시간의 화살이 한 방향으로만 흐르는 이유를 설명하며, 과거에서 미래로 시간이 진행되는 방향성을 나타냅니다. 시간과 공간은 하나라는 아인슈타인의 진술은 엔트로피의 증가를 시간의 방향과 연관시켜 이해할 수 있습니다.



As we age, there is a correlation between increased carbon dioxide in the body and increased entropy. As physical function declines during the aging process, energy metabolic efficiency may decrease and carbon dioxide emissions may increase. This may be related to the phenomenon of entropy, where disorder increases. In other words, the explanation is that aging reduces the efficiency of the body's systems, which in turn leads to an increase in entropy, which can ultimately be associated with the process of death.


나이가 들수록 체내 이산화탄소 증가와 엔트로피 증가 사이에는 상관관계가 있습니다. 노화 과정에서 신체 기능이 저하되면서 에너지 대사 효율이 감소하고 이산화탄소 배출이 증가할 수 있습니다. 이는 무질서가 증가하는 엔트로피 현상과 관련이 있을 수 있다. 즉, 노화가 신체 시스템의 효율성을 감소시키고, 이는 결국 엔트로피의 증가로 이어지며, 이는 궁극적으로 죽음의 과정과 연관될 수 있다는 설명이다.



John 10:10 says, “The thief (Satan) comes only to steal, kill, and destroy, but I have come so that they may have life and have it abundantly.” no see. This passage contrasts Jesus Christ with Satan to clearly demonstrate their purpose and role. Jesus came to give life, Satan comes to bring destruction and death


요한복음 10장 10절은 “도둑(사단)이 오는 것은 도적질하고 죽이고 멸망시키려는 것뿐이요 내가 온 것은 양으로 생명을 얻게 하고 풍성히 얻게 하려 함이라”고 말씀합니다. 아니 알겠습니다. 이 구절은 예수 그리스도를 사탄과 대조하여 그들의 목적과 역할을 분명하게 보여줍니다. 예수님은 생명을 주러 오셨고, 사탄은 멸망과 죽음을 가져오러 오셨습니다.




Life spoken of in the Bible is largely divided into two types. “Bios” is physical life and “Zoe” is eternal life. “Bios” is the everyday life we experience, life that includes the process of birth and death. On the other hand, “zoe” is eternal life that comes from God and can be obtained through Jesus Christ. The Bible emphasizes this eternal life, that is, eternal life, and shows that through this the relationship between humans and God, which was severed due to sin, is restored.


성경에서 말하는 인생은 크게 두 가지로 구분됩니다. 바이오스(Bios)는 육체적인 생명이고 조이(Zoe)는 영원한 생명이다. '바이오스'는 우리가 경험하는 일상, 탄생과 죽음의 과정을 담은 삶이다. 반면, “조에”는 하나님에게서 오는 영원한 생명, 예수 그리스도를 통해 얻을 수 있는 생명입니다. 성경은 이 영생, 즉 영생을 강조하며, 이를 통해 죄로 인해 단절된 인간과 하나님의 관계가 회복됨을 보여줍니다.




Satan, parasites, zombies Rockefeller and Blackrock Illuminati, zombies, scum Trump are planning to destroy Korea. 

 The United States, which imposes tariffs of up to 50% on steel and aluminum products, announced an additional 407 types of steel and aluminum derivatives. This means imposing a 50% tariff on the price of iron and aluminum used in the products. A large number of items exported to the United States, such as home appliances, transformers, turbines, and engines, were included.


사탄, 기생충, 좀비 록펠러와 검은바위 일루미나티, 좀비, 쓰레기 트럼프는 한국을 파괴하려고 계획하고 있습니다. 

 철강 및 알루미늄 제품에 최대 50%의 관세를 부과하는 미국은 407종의 철강 및 알루미늄 파생상품을 추가로 발표했습니다. 이는 제품에 사용되는 철과 알루미늄 가격에 50%의 관세를 부과하는 것을 의미합니다. 가전제품, 변압기, 터빈, 엔진 등 미국으로 수출되는 품목이 다수 포함됐다.


1 Peter 4:7 says, “The end of all things is at hand. Be sober and sober-minded and pray.” This verse emphasizes that we must recognize that the end of the world is approaching and live a life of wakefulness and prayer. This can be interpreted as an effort to escape from the disorderly world under Satan's control and achieve salvation. In other words, being sober, disciplined, and praying is a necessary attitude at the end of times, and through this, it can be interpreted to mean that one can escape from the disorderly world and achieve salvation.


베드로전서 4장 7절은 “만물의 마지막이 가까웠으니 정신을 차리고 정신을 차려 기도하라”고 말씀합니다. 이 구절은 우리가 세상 끝이 다가오고 있음을 인식하고 깨어 기도하는 삶을 살아야 함을 강조하고 있습니다. 이는 사탄의 지배를 받는 무질서한 세상에서 벗어나 구원을 이루려는 노력으로 해석할 수 있다. 즉 근신하고 절제하고 기도하는 것은 마지막 때 필요한 태도이며, 이를 통해 무질서한 세상에서 벗어나 구원을 이룰 수 있다는 뜻으로 해석할 수 있다.



John 18:36 emphasizes that Jesus' kingdom is not of this world. If that kingdom were of this world, Jesus' servants would have fought to protect themselves from the Roman Empire, but they did not. This shows that the kingdom of Jesus belongs to a spiritual realm on a different level from the political or physical power of this world.

요한복음 18장 36절은 예수님의 나라가 이 세상에 속한 것이 아님을 강조합니다. 그 왕국이 이 세상에 속했다면, 예수의 종들은 로마 제국으로부터 자신들을 보호하기 위해 싸웠을 것입니다. 그러나 그들은 그렇게 하지 않았습니다. 이는 예수님의 나라가 이 세상의 정치적, 물리적 세력과는 다른 차원의 영적인 영역에 속해 있음을 보여줍니다.




Each fraction represented in the Eye of Horus corresponds to 1/64, 1/32, 1/16, 1/8, 1/4, and 1/2. A closer look reveals that each fraction decreases by a factor of 1/2. If you were to draw the image as is, you would see a curiously clockwise curve. The 1/64th fraction represents the human sense of touch.

호루스의 눈에 표현된 각 분수는 1/64, 1/32, 1/16, 1/8, 1/4, 그리고 1/2에 해당합니다. 자세히 살펴보면 각 분수가 1/2씩 감소하는 것을 알 수 있습니다. 그림을 있는 그대로 그리면 시계 방향으로 이상한 곡선이 나타납니다. 1/64 분수는 인간의 촉각을 나타냅니다.


1/32 represents taste, 1/16 represents hearing. Furthermore, 1/8 represents thought, 1/4 represents sight, and 1/2 represents smell.
Also, let's unify the denominators of the fractions represented in the Eye of Horus to 64. While the denominators remain constant at 64—1/64, 2/64, 4/64, 8/64, 16/64, and 32/64—
the sum of the numerators is 1+2+4+8+16+32=63.







1/32는 미각, 1/16은 청각을 나타냅니다. 또한 1/8은 사고, 1/4은 시각, 1/2은 후각을 나타냅니다.
또한, 호루스의 눈에 나타난 분수의 분모를 64로 통일해 봅시다. 분모는 64로 일정하게 유지되지만(1/64, 2/64, 4/64, 8/64, 16/64, 32/64), 

분자의 합은 1+2+4+8+16+32=63입니다.



The presidential election was held on June 3rd, and Lee Jae-myung, a zombie parasite of Samsung and the Chinese Communist Party, was elected through fraud. (Including all Samsung Group affiliates controlled by the devil's cockroach, Lee Jae-yong, the total number of companies is 63.)


In the multiplication table, 6 x 3 = 18 = 666. 666 is the beast in the Book of Revelation.



6월 3일 대선이 치러졌고, 삼성과 중국 공산당의 좀비 기생충인 이재명이 부정선거를 통해

 당선되었습니다.

 (악마의 바퀴벌레 이재용이 지배하는 삼성그룹 계열사를 모두 포함하면 총 63개 기업입니다.)


구구단에서 6 x 3 = 18 = 666입니다. 666은 요한계시록에 나오는 짐승입니다.





What's truly shocking is that the Constitutional Court, the Republic of Samsung, and the Chinese Communist Party's zombie-like Constitutional Court judges postponed Yoon Seok-yeol's impeachment trial for a single reason: to coincide with the June 3rd presidential election.


The Constitution stipulates that a presidential election must be held within 60 days of impeachment.


The impeachment was declared on April 4th,

and the presidential election was held 60 days later, on June 3rd.


정말 충격적인 것은 헌법재판소, 삼성공화국, 그리고 좀비 같은 중국 공산당 헌법재판소 판사들이 윤석열 탄핵 재판을 단 하나의 이유로 연기했다는 것입니다. 바로 6월 3일 대선과 맞물리게 하기 위해서였습니다.


헌법은 탄핵 소추 후 60일 이내에 대통령 선거를 치러야 한다고 규정하고 있습니다.


탄핵은 4월 4일에 선포되었고,

대선은 60일 후인 6월 3일에 치러졌습니다.





?


In fact, it is a symbolic event that Lee Jae-yong and Hong Seok-hyun, the devils of the Republic of Samsung who control the Central Election Management Committee, the National Assembly, the judiciary, and the executive branch of the Republic of Korea, chose Lee Jae-myung. Hong Seok-hyun met Lee Jae-myung and Lee Jae-yong on March 20 (there is a story that the person who actually arranged this meeting was Lee Jae-yong's maternal uncle Hong Seok-hyun). After this meeting, conservative panelists (propagandists of the shadow regime), including Jeong Gyu-je and Jo Gap-je, began to praise Lee Jae-myung all at once, and then on March 26, he was found not guilty in the second trial for violating the election law. I think the timing is too exquisite to be dismissed as a simple coincidence.


사실 대한민국 중앙선거관리위원회, 국회, 사법부, 행정부를 쥐고 있는 삼성공화국의 악마들, 이재용과 홍석현이 이재명을 택한 것은 상징적인 사건입니다.홍석현은 3월 20일 이재명과 이재용을 만났습니다(실제로 이 만남을 주선한 사람이 이재용의 외삼촌 홍석현이었다는 이야기가 있습니다).이 만남 이후 정규제, 조갑제 등 보수 패널(그림자 정권의 선전원)들이 일제히 이재명을 칭찬하기 시작했고, 그러다 3월 26일 선거법 위반 혐의로 2심에서 무죄 판결을 받았습니다.단순한 우연으로 치부하기에는 타이밍이 너무 절묘하다고 생각합니다.




3:05
지금 재생 중
나중에 볼 동영상
현재 재생목록에 추가








The Eye of Horus holds a mathematical secret. It consists of six parts, each represented by a hieroglyphic symbol for a fraction with a numerator of 1, a symbol commonly used by the Babylonians and Egyptians of the time.

호루스의 눈은 수학적 비밀을 품고 있습니다. 여섯 부분으로 구성되어 있으며, 각 부분은 분자가 1인 분수를 나타내는 상형 문자로 표현되었는데, 이는 당시 바빌로니아인과 이집트인들이 흔히 사용했던 기호입니다.
The article argues that the Riemann Hypothesis, the pyramid of prime numbers, and the fractions associated with the Eye of Horus in quantum mechanics are deeply connected to human senses, particularly the law of diminishing returns. This law of diminishing returns is exemplified by the fact that when touch, taste, hearing, thinking, sight, and smell are represented as fractions of 1/64, 1/32, 1/16, 1/8, 1/4, and 1/2, respectively, the sum of these fractions is 63/64. Furthermore, it argues that this phenomenon is related to understanding animal mating behavior as a genetically programmed instinctive behavior.

이 논문은 리만 가설, 소수 피라미드, 그리고 양자역학에서 호루스의 눈과 관련된 분수가 인간의 감각, 특히 수확 체감의 법칙과 깊이 연관되어 있다고 주장합니다. 이 수확 체감의 법칙은 촉각, 미각, 청각, 사고, 시각, 후각을 각각 1/64, 1/32, 1/16, 1/8, 1/4, 1/2의 분수로 나타낼 때, 이 분수들의 합이 63/64라는 사실에서 잘 드러납니다. 더 나아가, 이 현상은 동물의 짝짓기 행동을 유전적으로 프로그램된 본능적 행동으로 이해하는 것과 관련이 있다고 주장합니다.














God's eyes are not the one-eyed Egyptian all-seeing eye, but the seven spirits, the seven eyes, that move throughout the earth. In other words, they are the Seven Eyes.
하나님의 눈은 이집트인들이 만물을 보는 외눈박이 눈이 아니라, 온 땅을 돌아다니는 일곱 영, 일곱 눈입니다. 다시 말해, 일곱 눈입니다.



The given fractional sequence 1/64, 1/32, 1/16, 1/8, 1/4, 1/2 is a geometric sequence in which each term is twice the previous one. The sixth fraction in this sequence is 1/2. The number 666 in Revelation 13 is interpreted as the number of the beast, and the expression 1/2 is mentioned as one of several interpretations of this number.

주어진 분수열 1/64, 1/32, 1/16, 1/8, 1/4, 1/2는 각 항이 이전 항의 두 배인 기하수열입니다. 이 수열의 여섯 번째 분수는 1/2입니다. 요한계시록 13장의 숫자 666은 짐승의 숫자로 해석되며, 1/2라는 표현은 이 숫자에 대한 여러 해석 중 하나로 언급됩니다.


Snakes are sexually attracted to snakes, not humans.

When we scientifically uncovered the circuit that causes sea cucumbers to shrink when touched, the circuit that causes rats to respond to rewards, and the circuit that causes owls to focus sounds on specific points in the dark, we discovered that all of these are zombie systems, like the mating instincts of animals.

뱀은 사람이 아니라 뱀에게 성적으로 끌립니다.

해삼을 만졌을 때 몸이 작아지는 회로, 쥐가 보상에 반응하는 회로, 올빼미가 어둠 속 특정 지점에 소리를 집중시키는 회로를 과학적으로 밝혀냈을 때, 우리는 이 모든 것이 동물의 짝짓기 본능처럼 좀비 시스템이라는 것을 발견했습니다.


It means a blueprint of a circuit that outputs an appropriate result based on
 specific input information. If the human brain is composed only of such circuit patterns, why do we feel alive and conscious? Why don't we feel like we've
 become a zombie, nothing more?

특정 입력 정보에 따라 적절한 결과를 출력하는 회로의 청사진을 의미합니다. 인간의 뇌가 그런 회로 패턴으로만 구성되어 있다면, 왜 우리는 살아있고 의식이 있다고 느끼는 걸까요? 왜 우리는 마치 좀비가 된 것 같은 느낌, 그 이상도 이하도 아닌 것 같은 느낌을 받지 못하는 걸까요?


The ways in which Heidegger reveals the meaning of his way of being are feelings such as anxiety and boredom. These emotions are not simply emotions, but are interpreted as a conscious state that resists the instincts and unconsciousness that dominate the way of being.


하이데거가 자신의 존재 방식의 의미를 드러내는 방식은 불안, 지루함 등의 감정이다. 이러한 감정은 단순한 감정이 아니라, 존재 방식을 지배하는 본능과 무의식에 저항하는 의식적 상태로 해석된다.


For Heidegger, emotions like pure love, anxiety, and boredom go beyond mere psychological states and become crucial modes of being that reveal the meaning of Dasein, or human existence. While these emotions may appear negative on the surface, they serve as catalysts for Dasein to move beyond its unconscious and instinctive state of being and the world, and toward a more essential mode of being.

하이데거에게 순수한 사랑, 불안, 권태와 같은 감정은 단순한 심리적 상태를 넘어 현존재, 즉 인간 존재의 의미를 드러내는 중요한 존재 양태가 됩니다. 이러한 감정은 표면적으로는 부정적으로 보일 수 있지만, 현존재가 무의식적이고 본능적인 존재 상태와 세계를 넘어 더욱 본질적인 존재 양태로 나아가도록 하는 촉매 역할을 합니다.






It's reasonable to understand animal mating behavior as a genetically programmed instinctual behavior. Mating behavior, which appears to be a simple emotion or unconscious reaction, is closer to an automatic response to fulfill basic needs for survival and reproduction. It can be viewed as operating like a computer program, following rules under specific conditions.


동물의 짝짓기 행동을 유전적으로 프로그래밍된 본능적 행동으로 이해하는 것은 타당합니다. 단순한 감정이나 무의식적 반응처럼 보이는 짝짓기 행동은 생존과 번식을 위한 기본적인 욕구를 충족하기 위한 자동적인 반응에 더 가깝습니다. 특정 조건 하에서 규칙을 따르는 컴퓨터 프로그램처럼 작동하는 것으로 볼 수 있습니다.





Instinct and the unconscious are two major factors that have a great influence

 on human behavior. They can cause us to repeatedly commit certain actions 

due to unconscious impulses or desires. For example, a thief may derive unconscious

 satisfaction from stealing, or a cheater may feel an unconscious sense of superiority 

through fraud. In the case of rapists, the combination of sexual and aggressive

 impulses can lead to unconscious behavior.


본능과 무의식은 인간의 행동에 큰 영향을 미치는 두 가지 주요 요소입니다. 무의식적인 

충동이나 욕망으로 인해 특정 행동을 반복적으로 저지르게 될 수 있습니다. 예를 들어,

 도둑은 도둑질을 통해 무의식적인 만족을 얻을 수도 있고, 사기꾼은 사기를 통해 무의식적인

 우월감을 느낄 수도 있습니다. 강간범의 경우 성적 충동과 공격적 충동이 결합되어 

무의식적인 행동을 유발할 수 있습니다.


In the chaos created by Satan, the pastor preaches to restore God's order. 


Unfortunately, selling one's parents for Satan's power and money suggests that 

material desires can overpower basic human morality. This shows that the desire 

for material things can be powerful at an unconscious level.


Just like the 95% dark matter that dominates the universe, the 95% instinct and

 unconsciousness that dominates humans are dominated by Satan's dark matter.


사탄이 만들어낸 혼란 속에서 목사는 하나님의 질서를 회복하기 위해 설교한다. 


불행하게도 사탄의 권력과 돈을 위해 부모를 파는 것은 물질적 욕망이 인간의 기본적인 

도덕성을 압도할 수 있음을 의미합니다. 이는 물질적인 것에 대한 욕구가 무의식적인 수준에서 

강력할 수 있음을 보여줍니다.


우주를 지배하는 95%의 암흑물질처럼, 인간을 지배하는 95%의 본능과 무의식도 사탄의 

암흑물질에 의해 지배되고 있습니다.





Both the constellation Orion and the Pyramids of Giza form planar triangles, but these

 triangles are made up of three points that do not lie on a straight line. These plane 

triangles have certain mathematical relationships in quantum mechanics or the

 Riemann hypothesis to fractions with denominators that are powers of 2 

(1/2, 1/4, 1/8, 1/16, 1/32, 1/64, etc.), and can be used to split triangles. 

The hidden connection between quantum mechanics and the Riemann 

zeta function suggests a relationship between the unconscious realm of

 quantum mechanics and the mathematical structure of the Riemann zeta function.


오리온자리와 기자 피라미드는 모두 평면형 삼각형을 형성하지만 이 삼각형은 직선 위에 있지 않은

 세 개의 점으로 구성됩니다. 이러한 평면 삼각형은 양자 역학 또는 리만 가설에서 분모가

 2의 거듭제곱(1/2, 1/4, 1/8, 1/16, 1/32, 1/64 등)인 분수에 대한 특정 수학적 관계를 

가지며 삼각형을 분할하는 데 사용할 수 있습니다. 양자역학과 리만 제타 함수 사이의 숨겨진

 연관성은 양자역학의 무의식적 영역과 리만 제타 함수의 수학적 구조 사이의 관계를 암시합니다.



There have been attempts to explain the similarities between the Riemann hypothesis's 

zero distribution, prime distribution, and quantum mechanical phenomena by linking

 them to unconscious behavioral patterns, particularly sexual instincts in animals. 

These attempts link the properties of the unconscious, such as disorder, increasing 

entropy, and the passage of time (towards death and the end), and have even led to

 the hypothesis that it can be controlled by dark matter, like gravity or magnetic fields.

리만 가설의 영 분포, 소수 분포, 양자역학적 현상 사이의 유사점을 무의식적인 행동 패턴, 특히 

동물의 성적 본능과 연결하여 설명하려는 시도가 있었습니다. 이러한 시도는 무질서, 엔트로피 

증가, 시간의 흐름(죽음과 종말을 향한) 등 무의식의 특성을 연결하고, 중력이나 자기장과 같은 

암흑물질에 의해 제어될 수 있다는 가설까지 이어졌습니다.




Atoms also resonate at the same time, but there is a time difference depending on the light medium.    If you just get the timing right   My mind can travel to other worlds

원자도 동시에 공명하는데, 가벼운 매질에 따라 시간차가 있습니다.    타이밍만 잘 맞추면   내 마음은 다른 세계로 여행할 수 있다


By exing the phenomenon of resonance between light and atoms, it is possible to make the speed of light appear to change under certain conditions. However, this does not mean that the speed of the light itself changes, but that the light appears to travel longer due to its interaction with the atoms. Using this concept effectively, we can even imagine ourselves mentally being transported to another world.


 



빛과 원자 사이의 공명 현상을 이용하면 특정 조건에서 빛의 속도가 변화하는 것처럼 보이게 하는 것이 가능합니다. 그러나 이는 빛 자체의 속도가 변한다는 의미가 아니라 원자와의 상호작용으로 인해 빛이 더 오래 이동하는 것처럼 보입니다. 이 개념을 효과적으로 사용하면 우리는 정신적으로 다른 세계로 이동하는 것을 상상할 수도 있습니다.














Blackpink Lisa's life is like a drama 'passed the audition 1 out of 4000'


블랙핑크 리사의 인생은 마치 드라마 '오디션 4000에 1등'




Blackpink Lisa was selected as the most influential person in Thailand. In a survey by Suandusit University, 28.1% of respondents chose Lisa, overwhelming other famous politicians. Lisa's influence goes beyond that of a popular idol, and she is evaluated as a national hero who has a positive impact on Thai society as a whole. 


Lisa's life, which would have ended normally, turned out to be more dramatic than in the drama, and as a result, Lisa's dimensional shift was miraculous and accurately timed.


블랙핑크 리사가 태국에서 가장 영향력 있는 인물로 선정됐다. 수안두싯대학교 조사에서는 응답자의 28.1%가 리사를 선택해 다른 유명 정치인들을 압도했다. 리사의 영향력은 인기 아이돌을 넘어 태국 사회 전반에 긍정적인 영향을 미치는 국민적 영웅으로 평가받고 있다. 


평범하게 끝났을 리사의 삶은 드라마보다 드라마틱하게 전개됐고, 그 결과 리사의 차원이동은 기적적이고 정확한 타이밍을 맞았다.



If Blackpink's Lisa had not participated in YG Entertainment's Thailand audition, it is highly likely that she would not have debuted as a Blackpink member. Lisa was the only foreign trainee who passed the YG Thailand audition in 2010, and after five years as a trainee, she debuted as Blackpink in 2016. Therefore, without the YG audition, her journey as a K-pop star would not have begun.


블랙핑크 리사가 YG엔터테인먼트 태국 오디션에 참여하지 않았다면 블랙핑크 멤버로 데뷔하지 못했을 가능성이 높다. 리사는 2010년 YG 태국 오디션에 합격한 유일한 외국인 연습생으로, 연습생 생활 5년 만에 2016년 블랙핑크로 데뷔했다. 따라서 YG 오디션이 없었다면 그녀의 K팝 스타로서의 여정은 시작되지 않았을 것이다.


My guess is that if it were JYP or SM instead of YG, a girl group like Blackpink wouldn't have been able to come out.


YG가 아니라 JYP나 SM이었다면 블랙핑크 같은 걸그룹은 나오지 못했을 것 같다.


Recently, negative opinions have been emerging regarding JYP Entertainment's girl group. In particular, concerns are growing about the future of JYP's girl group as problems within the company are raised regarding the withdrawal of KG, a member of the global girl group VCHA.


최근 JYP엔터테인먼트의 걸그룹에 대한 부정적인 여론이 나타나고 있다. 특히 글로벌 걸그룹 VCHA의 멤버 KG의 탈퇴와 관련해 사내 문제가 제기되면서 JYP 걸그룹의 미래에 대한 우려가 커지고 있다.

Christina, a black girl, excelled at the VCHA member audition, but Jinyoung Park strangely eliminated her.


Park Jin-young doesn't seem to have the vision or ability to create a girl group like Blackpink.


흑인 소녀 크리스티나는 VCHA 멤버 오디션에서 우수한 성적을 거두었지만 박진영은 이상하게 그녀를 탈락시켰다.


박진영에게는 블랙핑크 같은 걸그룹을 만들 만한 비전이나 능력이 없어 보인다.


In particular, it is a great fortune for Lisa that YG has discovered members to join Blackpink, such as Jenny Rosé and Jisoo.


In many ways, the timing of time was exquisitely combined for Lisa.

특히 제니 로제, 지수 등 블랙핑크에 합류할 멤버를 YG가 발굴한 것은 리사에게 큰 행운이다.


여러모로 리사에겐 시간의 타이밍이 절묘하게 결합됐다.


In particular, Lisa overcame tremendous hardships while working as a YG trainee for five years, but if it were not for the combination of various exquisite timings, the Lisa she is today would not have been born, and the miraculous timing that saved Lisa could not have been achieved through Lisa's efforts alone. If YG hadn't gone to Thailand and auditioned, if they hadn't known Lisa's abilities like JYP did, 

However, YG recognized Lisa's ability and placed first among 4,000 people in the audition, and was able to create Blackpink with members such as Jenny Rosé and Jisoo, which could not have been achieved through Lisa's efforts.


특히 리사는 5년 동안 YG 연습생으로 활동하면서 엄청난 시련을 이겨냈지만, 다양한 절묘한 타이밍의 조합이 아니었다면 지금의 리사는 탄생하지 못했을 것이고, 리사를 구한 기적 같은 타이밍도 리사의 노력만으로는 이룰 수 없었을 것이다. 만약 YG가 태국에 가서 오디션을 보지 않았다면, JYP처럼 리사의 능력을 몰랐다면, 

그러나 YG는 리사의 능력을 인정해 오디션에서 4000명 중 1위에 올랐고, 리사의 노력으로는 이룰 수 없었던 제니 로제, 지수 등의 멤버들로 블랙핑크를 탄생시킬 수 있었다.


What saved Lisa's ordinary life and enabled her to live a life in another dimension was Lisa's efforts, as well as the extraordinary abilities of other members such as YG and Blackpink's Jennie Rosé Jisoo, combined with exquisite timing like the Trinity.





리사의 평범한 삶을 구하고, 다른 차원의 삶을 살아갈 수 있게 한 것은 리사의 노력은 물론, YG, 블랙핑크 제니 로제 지수 등 다른 멤버들의 남다른 능력과 삼위일체 같은 절묘한 타이밍이 어우러진 결과였다.


The explanation of Blackpink Lisa's case was intended to make it easier to explain nirvana in Buddhism and salvation in Christianity.


블랙핑크 리사의 사례에 대한 설명은 불교의 열반과 기독교의 구원을 좀 더 쉽게 설명하기 위한 의도로 이뤄졌다.


Blackpink Lisa's miraculous success story is an example of dominating the dark matter world ruled by Satan Lucifer, and the situation and method are different from Buddhist liberation or Christian salvation where people are saved by moving to another spiritual dimension.


블랙핑크 리사의 기적적인 성공스토리는 사탄 루시퍼가 지배하는 암흑물질 세계를 지배한 사례로, 다른 영적 차원으로 이동해 사람들을 구원하는 불교해방이나 기독교 구원과는 상황과 방법이 다르다.


The world ruled by Satan Lucifer's dark matter is a time bomb heading towards death and apocalypse. 


In summary, Einstein explained the relationship between time and space by integrating space and time into one concept, and the second law of thermodynamics states that time flows in the direction of increasing entropy (disorder) in an isolated system, and that the universe will eventually come to an end due to the increase in entropy of the entire universe. It also includes the natural law that humans grow old and die.


사탄 루시퍼의 암흑물질이 지배하는 세계는 죽음과 종말을 향해 나아가는 시한폭탄이다. 


정리하면, 아인슈타인은 공간과 시간을 하나의 개념으로 통합하여 시간과 공간의 관계를 설명했는데, 열역학 제2법칙은 고립계에서 시간은 엔트로피(무질서)가 증가하는 방향으로 흐르며, 전체 우주의 엔트로피 증가로 인해 우주는 결국 종말을 맞이하게 된다는 점이다. 여기에는 인간이 늙고 죽는 자연의 법칙도 포함됩니다.



The world ruled by Satan and Lucifer and the material world of dark matter are made up of various elements, each with their own unique properties and interactions. During this interaction process, substances are not only differentiated from each other, but sometimes show unique differentiation.  It can also appear in social phenomena


 Just like YG chose Lisa out of 4,000 people at the Thai audition.


사탄과 루시퍼가 통치하는 세계와 암흑물질이라는 물질세계는 다양한 원소들로 구성되어 있으며, 각각은 고유한 특성과 상호작용을 갖고 있습니다. 이러한 상호작용 과정에서 물질들은 서로 구별될 뿐만 아니라, 때로는 독특한 차별화를 보이기도 한다.  사회현상에서도 나타날 수 있다

 YG가 태국 오디션에서 4000명 중 리사를 선택한 것처럼 말이다.


The Riemann hypothesis, which governs Satan's animal instincts, the unconscious mind, and the material world, is a conjecture that the zero points of the Riemann zeta function, that is, points where the function value is 0, are distributed on a specific straight line. This hypothesis is closely related to the distribution of prime numbers and is considered a mathematical challenge. Additionally, zero point, prime number, pyramid, zero dimension, circulation, quantum mechanics, etc. are keywords used to understand and approach the Riemann hypothesis.

사탄의 동물적 본능과 무의식, 물질세계를 관장하는 리만가설은 리만 제타함수의 영점, 즉 함수값이 0이 되는 점이 특정한 직선상에 분포되어 있다는 추측이다. 이 가설은 소수의 분포와 밀접하게 관련되어 있으며 수학적 도전으로 간주됩니다. 또한 영점, 소수, 피라미드, 영차원, 순환, 양자역학 등은 리만 가설을 이해하고 접근하는 데 사용되는 키워드이다.





To explain it more simply,



Women who have achieved great material success, like Blackpink's Lisa, have very high standards for choosing a groom. 

If we remove the parts that don't meet Lisa's high standards, 


This leaves very little left. 



Converging to 1 means that there will eventually be only one left.



Out of 150 million sperm, only one sperm unites with an egg. This is the material world ruled by Satan and dark matter.


좀 더 쉽게 설명하자면,



블랙핑크 리사처럼 물질적으로 큰 성공을 거둔 여성들은 신랑을 고르는 기준이 매우 높다. 

리사의 높은 기준에 맞지 않는 부분을 제거한다면, 


이렇게 하면 거의 남지 않습니다. 



1로 수렴한다는 것은 결국 하나만 남게 된다는 것을 의미합니다.



1억 5천만 개의 정자 중 단 하나의 정자만이 난자와 결합합니다. 이곳은 사탄과 암흑물질이 지배하는 물질세계이다.


In the material world ruled by Satan, dirty discrimination is the basis. However, the image of Jesus Christ treating prostitutes, slaves, and strangers who were treated most poorly at the time of Jesus Christ without discrimination makes us think of a fair God that transcends time and space.


사탄이 지배하는 물질세계에서는 더러운 차별이 기본입니다. 그러나 예수 그리스도 당시 가장 가난하게 대우받았던 창녀와 노예, 나그네들을 차별 없이 대하시는 예수 그리스도의 모습은 시공을 초월하여 공평하신 하나님을 생각하게 합니다.

Words and moments that are valuable in living, that a beautiful figure transcends time

시간을 초월한 아름다운 모습, 살아가는데 소중한 말과 순간들

Listening to this music, I really miss those days when everything was exciting.

이 음악을 들으니 모든 것이 설레이던 그 시절이 참 그립네.

If you have seen this movie before as a child, it is a song that transcends time and exudes emotion with just the prelude.

Sophie Marceau in her Leeds days..ha..the word itself is innocence

어릴 적 이 영화를 본 적이 있다면, 전주곡만으로도 시간을 뛰어넘어 감동을 주는 노래다.

리즈 시절의 소피 마르소..하..말 자체가 순수다.






People want to find it even in their dreams and imaginations

A dimension indistinguishable from time and space

사람들은 꿈과 상상 속에서도 찾고 싶어해 시간과 공간을 구분할 수 없는 차원

Existence beyond time and space

시간과 공간을 초월한 존재

Satan's henchmen who do not realize the word that God exists by himself and are dominated by worldly material things.

하나님이 홀로 계신다는 말씀을 깨닫지 못하고 세상 물질의 지배를 받는 사탄의 심복들.

If the material world is a place subject to the limitations of time and space, heaven is an equal spiritual space where time and space do not distinguish.

물질계가 시간과 공간의 제약을 받는 곳이라면 천국은 시간과 공간이 구분되지 않는 평등한 영적 공간이다.



Money and material things under Satan's control will rot away with human time.

The spirit of Jesus Christ and God transcends the times in a life that openly exposes and resists the absurdities of the huge cartel and system.

And it exists beyond time and space.

사탄의 지배 아래 있는 돈과 물질은 인간의 시간과 함께 썩어 없어질 것입니다. 거대한 카르텔과 체제의 부조리를 적나라하게 폭로하고 저항하는 삶에 예수 그리스도와 하나님의 정신이 시대를 초월한다. 그리고 그것은 시간과 공간을 초월하여 존재합니다.







The 666 beast in Revelation 13 has 10 horns and 7 heads. 10 and 7 in 666 So subtract 17 from 666 649 appears. 6 times 4 times 9 = 216 6 times 6 times 6 = 216 How does this match up? Is this a coincidence?   요한계시록 13장의 666짐승은 10개 뿔과 7개 머리를 가지고 있다.     666에서 10과 7     그러니까 666에서 17을 빼면     649가 나온다.       6곱하기4곱하기9 = 216     6곱하기6곱하기6 = 216       어떻게 이렇게 일치하는가? 이게 우연인가?



It is unfortunate that the world is becoming increasingly evil and chaotic due to the second law of thermodynamics controlled by Satan, that is, the law of increasing entropy, and that romance, justice, and purity are disappearing.

Young people who go to church are disappearing. This is evidence that the young people of the world are increasingly dominated by materialism and Satan's tyranny.

An evil world where purity is disappearing is coming due to the fake COVID-19 mRNA vaccine and genetically modified foods created by Satan, nano fine dust, environmental pollution, and increased carbon dioxide.

사탄이 조종하는 열역학 제2법칙, 즉 엔트로피 증가의 법칙으로 인해 세상이 점점 더 사악하고 혼란스러워지고 있으며, 낭만, 정의, 순수함이 사라지고 있다는 것은 안타까운 일입니다.

교회에 다니는 젊은이들이 사라지고 있습니다. 이는 세상의 젊은이들이 물질주의와 사탄의 폭정에 점점 더 지배당하고 있다는 증거입니다.

사탄이 만든 가짜 코로나19 mRNA 백신과 유전자 변형 식품, 나노 미세먼지, 환경 오염, 이산화탄소 증가로 인해 순수함이 사라지는 악한 세상이 도래하고 있습니다.







The energy of the universe is constant, but change continues. Eventually, entropy can no longer increase, resulting in an extremely disorderly and chaotic situation, which ultimately leads to destruction.

The second law of thermodynamics, the law of increasing entropy, makes today's youth more materialistic and rude than people of the past, and plays a role similar to the mark of the beast, 666, in Revelation 13:18.


우주의 에너지는 불변하지만 변화는 계속됩니다. 결국 엔트로피는 더 이상 증가할 수 없게 되어 극도로 무질서하고 혼돈스러운 상황을 초래하고, 이는 결국 파괴로 이어집니다.

열역학 제2법칙, 즉 엔트로피 증가의 법칙은 오늘날의 젊은이들을 과거 사람들보다 더 물질주의적이고 무례하게 만들며, 요한계시록 13장 18절에 나오는 짐승의 표인 666과 유사한 역할을 합니다.





If that happens, no more natural changes will be possible. This is the end of the universe, which is called heat death. And if you look at it, the second law seems like a dark prophecy that the entire universe, including humans, is marching heavily toward its end.

그렇게 되면 더 이상 자연적인 변화는 불가능해질 것입니다. 이것이 바로 우주의 종말, 즉 열사(熱死)입니다. 그리고 자세히 살펴보면, 제2법칙은 인간을 포함한 온 우주가 종말을 향해 무겁게 나아가고 있다는 암울한 예언처럼 보입니다.






The Second Law of Thermodynamics, the Law of Entropy Increase, Leads to Satan's Disorder and the End Signs of the End Bible Answer: "The attacking forces of the end are apostasy and deeds... The refuge is the true Mount Zion" We are hearing the words of the Lord that can be used in Matthew 24 after the resurrection, and the words of the Lord that give the words of the end of the world. The temple of God was destroyed without leaving one stone upon another (Matthew 24:1-3). The beginning of the destruction of the temple of God due to the act of the end is revealed through Matthew 24:4 and below, and it is said that this became the source of people's delusion.

열역학 제2법칙 엔트로피 증가 법칙, 사탄의 무질서와 종말로 이끈다

종말의 징조

성경 답:

"종말의 공격 세력은 배도와 행실이로다... 피난처는 참 시온산이로다"

우리는 부활 후 마태복음 24장에서 사용될 수 있는 주님의 말씀, 그리고 세상 종말의 말씀을 주시는 주님의 말씀을 듣고 있습니다. 하나님의 성전은 돌 위에 돌 하나도 남지 않고 무너졌습니다(마태복음 24:1-3). 종말의 행위로 인한 하나님의 성전 파괴의 시작은 마태복음 24장 4절 이하를 통해 드러나며, 이것이 사람들의 미혹의 근원이 되었다고 합니다.





In Buddhism, what are the signs of the end times, what are the beginning and end of events, and where is the refuge during this time?

불교에서는 종말의 징조는 무엇이고, 사건의 시작과 끝은 무엇이며, 이 시기에 귀의처는 어디인가요?



The term “the last days” appears once in the 14th chapter of the Lotus Sutra, “The Chapter on Comfortable Conduct.” In Buddhism, the term “the last days” can be seen as “the five turbid evil worlds.” The five turbid evil worlds (五濁惡世) mean “five impurities.” The world we live in now is called the “last days.” This is because it is an era in which the karma of the five turbid evil worlds runs rampant. The various social evils and mental and physiological evils that cannot be avoided wherever people live are classified into five categories and called the five turbid evil worlds (五濁惡世). It means a dirty world teeming with impure negativity.

"말세(末世)"라는 용어는 법화경 14편 "편행품(偏行品)"에 한 번 등장합니다. 불교에서 "말세"라는 용어는 "오탁악세계(五濁惡世)"로 볼 수 있습니다. 오탁악세계(五濁惡世)는 "다섯 가지 부정함"을 의미합니다. 지금 우리가 사는 세상을 "말세"라고 부릅니다. 오탁악세계의 업이 횡행하는 시대이기 때문입니다. 사람들이 사는 곳 어디에서나 피할 수 없는 여러 가지 사회적 악과 정신적, 생리적 악을 다섯 가지로 분류하여 오탁악세계(五濁惡世)라고 합니다. 불순한 부정으로 가득 찬 더러운 세상을 의미합니다.


However, the emergence of life forms, including humans, is a mysterious phenomenon from a thermodynamic perspective. In order for life forms to be born, a huge number of molecules must be arranged precisely. Therefore, the birth of life forms is a phenomenon that violates the second law. Rather, death, in which everything is dispersed into nature, seems a more natural phenomenon. Is there a problem with the second law?


하지만 인간을 포함한 생명체의 출현은 열역학적 관점에서 불가사의한 현상입니다. 생명체가 탄생하려면 엄청난 수의 분자들이 정밀하게 배열되어야 합니다. 따라서 생명체의 탄생은 제2법칙에 위배되는 현상입니다. 오히려 모든 것이 자연 속으로 흩어지는 죽음이 더 자연스러운 현상으로 보입니다. 제2법칙에 문제가 있는 걸까요?



What appears in such a process is temporary chaos. Ultimately, modern thermodynamics makes a bright prediction that our universe will constantly change while going through a state of chaos and giving birth to a new order, that is, life. >>


그러한 과정에서 나타나는 것은 일시적인 혼돈입니다. 궁극적으로 현대 열역학은 우리 우주가 혼돈 상태를 거치면서 끊임없이 변화하고 새로운 질서, 즉 생명을 탄생시킬 것이라는 밝은 예측을 내놓습니다. >>

For life to evolve from nonliving atoms or molecules, there had to be organization and self-assembly from lower to higher states in precise alignment. However, the second law of thermodynamics shows that molecules will always break down without intelligent intervention from outside.


무생물 원자나 분자에서 생명체가 진화하려면, 낮은 상태에서 높은 상태로 정밀한 정렬을 이루며 조직화되고 자가 조립되어야 했습니다. 그러나 열역학 제2법칙은 분자는 외부의 지적인 개입 없이도 항상 분해될 것임을 보여줍니다.


In a paper titled “Rethinking the Second Law of Thermodynamics,” Granville Sewell, a mathematics professor at the University of Texas at El Paso, shows that the idea that nature could have created the complex structure of DNA on its own is as improbable as the idea that nature could have created a computer. In both cases, the second law of thermodynamics would be violated.


텍사스 대학교 엘파소 캠퍼스의 수학 교수인 그랜빌 세웰은 "열역학 제2법칙 재고"라는 제목의 논문에서 자연이 스스로 복잡한 DNA 구조를 창조할 수 있다는 생각은 자연이 컴퓨터를 창조할 수 있다는 생각만큼이나 불가능하다고 밝혔습니다. 두 경우 모두 열역학 제2법칙이 위배됩니다.

Just as the Illuminati zombies created the fake mRNA vaccine for COVID-19 and those who opposed it were subject to a huge attack 


Considering the harsh opposition and attacks that many evolutionists would face when evolution is academically challenged, the editor's fear of publishing the paper is perhaps not surprising

일루미나티 좀비들이 코로나19 가짜 mRNA 백신을 개발했고, 이에 반대했던 사람들이 엄청난 공격을 받았던 것처럼 말입니다.


진화론이 학문적으로 도전받을 때 많은 진화론자들이 직면하게 될 격렬한 반대와 공격을 고려하면, 편집자가 논문 게재를 두려워하는 것은 어쩌면 당연한 일일지도 모릅니다.




In other words, it is overwhelmingly more likely that the atoms that make up a computer (and by the same token, DNA and the first cells) will disperse rather than spontaneously assemble (self-assemble into patterns that provide rich information). The key formula expressing the rate of change of entropy is included in textbooks explaining the standard laws of thermodynamics, but its implications are rarely discussed. The upshot is that the only way a computer could appear in a room is not by moving materials and energy, such as photons of light, from room to room, but by someone building a computer and placing it in the room.

다시 말해, 컴퓨터를 구성하는 원자(그리고 DNA와 최초의 세포)가 자발적으로 조립(풍부한 정보를 제공하는 패턴으로 자가 조립)될 가능성보다 분산될 가능성이 훨씬 더 높습니다. 엔트로피 변화율을 표현하는 핵심 공식은 표준 열역학 법칙을 설명하는 교과서에 포함되어 있지만, 그 함의는 거의 논의되지 않습니다. 결론적으로, 컴퓨터가 방에 나타날 수 있는 유일한 방법은 빛의 광자처럼 방에서 방으로 물질과 에너지를 전달하는 것이 아니라, 누군가가 컴퓨터를 제작하여 방에 설치하는 것입니다.





Likewise, the way we get DNA is not that solar energy is transferred to chemicals on Earth, but that someone built DNA and placed it in living organisms on Earth. That scenario will sound familiar to those who have read Exodus 20:11: “For in six days the Lord made the heavens and the earth, the sea, and all that is in them, and rested on the seventh day.” (Exodus 20:11)

마찬가지로, 우리가 DNA를 얻는 방식은 태양 에너지가 지구상의 화학 물질로 전달되는 것이 아니라, 누군가 DNA를 만들어 지구상의 생물에 심어 놓는 것입니다. 출애굽기 20장 11절을 읽어본 사람이라면 이러한 시나리오가 익숙하게 들릴 것입니다. "이는 엿새 동안에 여호와가 하늘과 땅과 바다와 그 가운데 모든 것을 만들고 일곱째 날에 쉬었음이니라." (출애굽기 20:11)



Entropy increase is a concept that represents the degree of disorder, or the degree of chaos in a system, and all matter and energy are natural laws that seek to reach a state of thermal equilibrium, which is the second law of thermodynamics. However, living organisms survive by organizing and maintaining themselves against this law of increasing entropy.

엔트로피 증가는 시스템의 무질서 또는 혼돈의 정도를 나타내는 개념이며, 모든 물질과 에너지는 열역학 제2법칙인 열 평형 상태에 도달하려는 자연 법칙입니다. 그러나 생명체는 이 엔트로피 증가 법칙에 반하여 스스로를 조직하고 유지함으로써 생존합니다.


Moreover, for it to evolve into an increasingly ordered structure, not just to maintain that state, and especially for life to emerge as an incredibly complex and well-organized structure, conditions that are truly unimaginable would be required. The probability of this happening by chance would be ridiculously small. It would be impossible, to put it bluntly.


더욱이, 생명체가 단순히 그 상태를 유지하는 데 그치지 않고 점점 더 질서 있는 구조로 진화하려면, 그리고 특히 생명체가 믿을 수 없을 정도로 복잡하고 잘 조직된 구조로 출현하려면, 상상조차 할 수 없는 조건들이 요구될 것입니다. 이것이 우연히 일어날 확률은 터무니없이 낮을 것입니다. 직설적으로 말하면, 불가능할 것입니다.



God is telling us about the place of refuge where the saints must go to be saved.

하나님께서는 성도들이 구원받기 위해 가야 할 피난처에 관해 우리에게 말씀하고 계십니다.





The refuge where the saints will be saved is called the ‘mountain to avoid’ in Matthew 24:16. In Revelation 14:1 and below, it is called Mount Zion, and it is the place where the first ripe fruits of the 144,000 are harvested.

In Revelation 6:12 and below, the sun, moon, and stars in the sky darken and fall to the ground, and in Revelation 7:1 and below, the twelve tribes put the seal of God on the 144,000 and the white multitude, and in Revelation 15:2 and below, it is said that they overcome the mark of the beast.

<Revelation 13:18 and 666 The Mark of the Beast <The DNA of those who are vaccinated with the Samsung Bio vaccine, a fraudulent COVID-19 scam, changes.

성도들이 구원받을 피난처는 마태복음 24장 16절에서 ‘피해야 할 산’으로 불립니다. 요한계시록 14장 1절 이하에서는 시온산으로 불리며, 14만 4천 명의 첫 열매를 거두어들이는 곳입니다.

요한계시록 6장 12절 이하에서는 하늘의 해와 달과 별들이 어두워져 땅에 떨어지고, 요한계시록 7장 1절 이하에서는 열두 지파가 14만 4천 명과 흰 무리에게 하나님의 인을 치고, 요한계시록 15장 2절 이하에서는 짐승의 표를 이긴다고 기록되어 있습니다.

Who did John see on the sea of ​​glass?


“Then I saw something like a sea of ​​glass mixed with fire, and those who had gotten the victory over the beast and his image and the number of his name were standing on the sea of ​​glass, holding harps of God. And they sang the song of Moses the servant of God, and the song of the Lamb, saying:” (Rev. 15:2-3)


요한은 유리 바다에서 누구를 보았습니까?


“또 내가 보니 불이 섞인 유리 바다 같은 것이 있고 짐승과 그의 우상과 그의 이름의 수를 이기고 이긴 자들이 유리 바다 위에 서서 하나님의 거문고를 가지고 있더라. 그들이 하나님의 종 모세의 노래와 어린 양의 노래를 부르며 이르되” (요한계시록 15:2-3)


The sea of ​​glass mixed with fire refers to a place as clear as crystal. This is before the throne of God, and Revelation 4:6 says that there was a “sea of ​​glass like crystal before the throne.” 2,000 years ago, glass was very precious, so the term “sea of ​​glass” was used to describe a wide, clear, transparent place. Therefore, this place would be a space that shines like jewels spread out before the throne. On the sea of ​​glass, “those who have overcome the beast and his image and the number of his name” are singing the song of Moses and the song of the Lamb with harps.

불이 섞인 유리 바다는 수정처럼 맑은 곳을 가리킵니다. 이곳은 하나님의 보좌 앞이며, 요한계시록 4장 6절은 “보좌 앞에 수정 같은 유리 바다가 있었다”고 말씀합니다. 2천 년 전, 유리는 매우 귀했기에 “유리 바다”라는 용어는 넓고 맑고 투명한 곳을 묘사하는 데 사용되었습니다. 따라서 이곳은 보좌 앞에 펼쳐진 보석처럼 빛나는 공간일 것입니다. 유리 바다 위에서는 “짐승과 그의 우상과 그의 이름의 수를 이긴 자들”이 거문고를 연주하며 모세의 노래와 어린 양의 노래를 부릅니다.


Overcoming and escaping means overcoming the temptation of Babylon and accepting the message of the three angels. Just as Moses and Israel sang a song of thanksgiving and praise on the other side of the Red Sea after receiving a dramatic salvation (Exodus 15), the people who have now overcome all the hardships and been saved sing a song of salvation, a song of experience that no one else can sing.


극복하고 피한다는 것은 바벨론의 유혹을 이기고 세 천사의 메시지를 받아들이는 것을 의미합니다. 모세와 이스라엘이 홍해 건너편에서 극적인 구원을 받고 감사와 찬양의 노래를 불렀던 것처럼(출애굽기 15장), 이제 모든 고난을 극복하고 구원받은 사람들은 구원의 노래, 다른 누구도 부를 수 없는 체험의 노래를 부릅니다.




<요한계시록 13장 18절과 666절 짐승의 표> 사기성 코로나19 백신인 삼성바이오 백신 접종자의 DNA가 변한다.




German 3rd generation immigrant Trump's selfish dictatorship and tyranny increases entropy

독일 3세 이민자 트럼프의 이기적인 독재와 폭정은 엔트로피를 증가시킨다




The United States, once the land of freedom and hope, has fallen into the hands of some dictators. The situation is getting more and more bizarre.

Of course, there is the threat of the Chinese Communist Party, but Trump is actually expanding the Chinese Communist Party's international influence.

Instead, Trump is withdrawing from international organizations to expand the Chinese Communist Party's international influence, and the United States is not involved at all, and is increasing the entropy of Satan through tyranny in the United States.

한때 자유와 희망의 땅이었던 미국은 일부 독재자들의 손에 넘어갔습니다. 상황은 점점 더 기이해지고 있습니다.

물론 중국 공산당의 위협도 있지만, 트럼프는 사실상 중국 공산당의 국제적 영향력을 확대하고 있습니다.

대신 트럼프는 중국 공산당의 국제적 영향력을 확대하기 위해 국제기구에서 철수하고 있으며, 미국은 이에 전혀 관여하지 않고 미국 내 폭정을 통해 사탄의 엔트로피를 증폭시키고 있습니다.

The Chinese Communist Party and Samsung Republic zombie Lee Jae-myung and his gang, who control Seoul National University, the National Assembly, the judiciary, and the executive branch, can create chaos and disorder in Korea and pose a threat of destruction. The same goes for the United States. 

However, simple immigrants cannot be a threat.

서울대, 국회, 사법부, 행정부를 장악한 중국 공산당과 삼성공화국 좀비 이재명과 그의 패거리는 한국에 혼란과 무질서를 조성하고 파괴의 위협을 가할 수 있습니다. 미국도 마찬가지입니다.

하지만 단순 이민자는 위협이 될 수 없습니다.

Dictators like Trump, a third-generation German immigrant, do not want to know the detailed stories and processes of immigrants. His only interest is whether the result is money and material power.

독일 이민 3세인 트럼프 같은 독재자들은 이민자들의 자세한 사연이나 과정을 알고 싶어 하지 않습니다. 그의 유일한 관심사는 그 결과가 돈과 물질적 권력으로 이어질지 여부입니다.




AlphaFold's analysis revealed that in addition to Izumo1 and Spakka-6, three other proteins, including 'Tmem81', must also be combined to form a complex that can attach to the egg. 


<If any one of these three proteins is missing, the secret key to binding the egg and sperm cannot be found.>


알파폴드의 분석 결과, 이즈모1과 스파카-6 외에도 'Tmem81'을 포함한 세 가지 다른 단백질이 결합되어 난자에 부착될 수 있는 복합체를 형성해야 한다는 것이 밝혀졌습니다.


<이 세 가지 단백질 중 하나라도 결핍되면 난자와 정자를 결합하는 비밀 열쇠를 찾을 수 없습니다.>



The three aspects of quantum mechanics—the wave function, the path integral, and the operator—look different but are essentially the same. This article is titled "The Quantum Trinity

The genetic code of DNA, in which three DNA bases are grouped together to specify one amino acid, and the number and arrangement of these bases is called genetic information.

3개의 DNA 염기가 모여서 하나의 아미노산을 특정하는 DNA의 유전암호와 이들 염기의 수와 배열을 유전정보라고 한다.




After all, none of the three symmetries C, P, and T exist individually in nature, but only a combination of the three, CPT.

결국, 세 가지 대칭 C, P, T 중 어느 것도 자연계에 개별적으로 존재하지 않고 세 가지의 조합인 CPT만 존재합니다.



Three quarks come together to form a proton or neutron, which are the fundamental particles that make up the nucleus and ultimately the mass of a human being.

3개의 쿼크가 모여 양성자나 중성자를 형성하는데, 이는 원자핵을 구성하고 궁극적으로 인간의 질량을 이루는 기본 입자입니다.



Behind the world there is a hidden quantum trinity order and law of God Jesus Christ.

Consciousness and unconsciousness

Just as real numbers and pure imaginary numbers are part of the complex number system.

세상 뒤에는 하나님 예수 그리스도의 숨겨진 양자 삼위일체 질서와 법칙이 있습니다.

의식과 무의식

실수와 순수한 허수가 복소수 체계의 일부인 것처럼 말입니다.







The fact that your heart beats faster when you look at the opposite sex is not a conscious decision, but an unconscious phenomenon caused by the action of the sympathetic nervous system in the autonomic nervous system. It can be triggered by emotions such as love or excitement, and can be considered an instinctive automatic response. While animal mating is governed by the unconscious and instincts, humans can control their instincts and unconsciousness through consciousness.


이성을 보면 심장이 더 빨리 뛰는 것은 의식적인 결정이 아니라 자율신경계 중 교감신경계의 작용으로 인한 무의식적인 현상이다. 사랑이나 설렘 등의 감정에 의해 촉발될 수도 있고 본능적인 자동반응이라고 볼 수 있다. 동물의 교미는 무의식과 본능에 의해 지배되지만, 인간은 의식을 통해 본능과 무의식을 통제할 수 있다.




The fundamental components of the universe are information, matter, energy, and mathematical imaginary, real, and complex numbers. Although these are different domains, they are closely connected to each other and make up the universe. In other words, if even one of these were to disappear, the universe would not exist.

It is the quantum trinity.

우주의 기본 구성 요소는 정보, 물질, 에너지, 그리고 수학적 허수, 실수, 복소수입니다. 이들은 서로 다른 영역이지만, 서로 밀접하게 연결되어 우주를 구성합니다. 다시 말해, 이 중 하나라도 사라진다면 우주는 존재하지 않을 것입니다.

이것이 바로 양자 삼위일체입니다.


There are two main reasons why the Chinese Communist Party is viewed so negatively around the world. First, the Chinese Communist Party’s dictatorial political system, human rights violations, and lack of hope. 

In the end, Trump is making America like the Chinese Communist Party. 


1 Corinthians 13:13 KRV


Now these three remain: faith, hope, love. But the greatest of these is love.


중국 공산당이 전 세계적으로 그토록 부정적인 평가를 받는 데에는 두 가지 주요 이유가 있습니다. 첫째, 중국 공산당의 독재 정치 체제, 인권 침해, 그리고 희망의 부재입니다.

결국 트럼프는 미국을 중국 공산당처럼 만들고 있습니다.


고린도전서 13:13 KRV


믿음, 소망, 사랑, 이 세 가지는 항상 있을 것입니다. 그러나 이 중에 제일은 사랑입니다.



4:23
지금 재생 중





지금 재생 중





God is telling us about the place of refuge where the saints must go to be saved.

하나님께서는 성도들이 구원받기 위해 가야 할 피난처에 관해 우리에게 말씀하고 계십니다.





The refuge where the saints will be saved is called the ‘mountain to avoid’ in Matthew 24:16. In Revelation 14:1 and below, it is called Mount Zion, and it is the place where the first ripe fruits of the 144,000 are harvested.

In Revelation 6:12 and below, the sun, moon, and stars in the sky darken and fall to the ground, and in Revelation 7:1 and below, the twelve tribes put the seal of God on the 144,000 and the white multitude, and in Revelation 15:2 and below, it is said that they overcome the mark of the beast.

<Revelation 13:18 and 666 The Mark of the Beast <The DNA of those who are vaccinated with the Samsung Bio vaccine, a fraudulent COVID-19 scam, changes.

성도들이 구원받을 피난처는 마태복음 24장 16절에서 ‘피해야 할 산’으로 불립니다. 요한계시록 14장 1절 이하에서는 시온산으로 불리며, 14만 4천 명의 첫 열매를 거두어들이는 곳입니다.

요한계시록 6장 12절 이하에서는 하늘의 해와 달과 별들이 어두워져 땅에 떨어지고, 요한계시록 7장 1절 이하에서는 열두 지파가 14만 4천 명과 흰 무리에게 하나님의 인을 치고, 요한계시록 15장 2절 이하에서는 짐승의 표를 이긴다고 기록되어 있습니다.

Who did John see on the sea of ​​glass?


“Then I saw something like a sea of ​​glass mixed with fire, and those who had gotten the victory over the beast and his image and the number of his name were standing on the sea of ​​glass, holding harps of God. And they sang the song of Moses the servant of God, and the song of the Lamb, saying:” (Rev. 15:2-3)


요한은 유리 바다에서 누구를 보았습니까?


“또 내가 보니 불이 섞인 유리 바다 같은 것이 있고 짐승과 그의 우상과 그의 이름의 수를 이기고 이긴 자들이 유리 바다 위에 서서 하나님의 거문고를 가지고 있더라. 그들이 하나님의 종 모세의 노래와 어린 양의 노래를 부르며 이르되” (요한계시록 15:2-3)


The sea of ​​glass mixed with fire refers to a place as clear as crystal. This is before the throne of God, and Revelation 4:6 says that there was a “sea of ​​glass like crystal before the throne.” 2,000 years ago, glass was very precious, so the term “sea of ​​glass” was used to describe a wide, clear, transparent place. Therefore, this place would be a space that shines like jewels spread out before the throne. On the sea of ​​glass, “those who have overcome the beast and his image and the number of his name” are singing the song of Moses and the song of the Lamb with harps.

불이 섞인 유리 바다는 수정처럼 맑은 곳을 가리킵니다. 이곳은 하나님의 보좌 앞이며, 요한계시록 4장 6절은 “보좌 앞에 수정 같은 유리 바다가 있었다”고 말씀합니다. 2천 년 전, 유리는 매우 귀했기에 “유리 바다”라는 용어는 넓고 맑고 투명한 곳을 묘사하는 데 사용되었습니다. 따라서 이곳은 보좌 앞에 펼쳐진 보석처럼 빛나는 공간일 것입니다. 유리 바다 위에서는 “짐승과 그의 우상과 그의 이름의 수를 이긴 자들”이 거문고를 연주하며 모세의 노래와 어린 양의 노래를 부릅니다.


Overcoming and escaping means overcoming the temptation of Babylon and accepting the message of the three angels. Just as Moses and Israel sang a song of thanksgiving and praise on the other side of the Red Sea after receiving a dramatic salvation (Exodus 15), the people who have now overcome all the hardships and been saved sing a song of salvation, a song of experience that no one else can sing.


극복하고 피한다는 것은 바벨론의 유혹을 이기고 세 천사의 메시지를 받아들이는 것을 의미합니다. 모세와 이스라엘이 홍해 건너편에서 극적인 구원을 받고 감사와 찬양의 노래를 불렀던 것처럼(출애굽기 15장), 이제 모든 고난을 극복하고 구원받은 사람들은 구원의 노래, 다른 누구도 부를 수 없는 체험의 노래를 부릅니다.




<요한계시록 13장 18절과 666절 짐승의 표> 사기성 코로나19 백신인 삼성바이오 백신 접종자의 DNA가 변한다.




The 666 beast in Revelation 13 has 10 horns and 7 heads. 10 and 7 in 666 So subtract 17 from 666 649 appears. 6 times 4 times 9 = 216 6 times 6 times 6 = 216 How does this match up? Is this a coincidence?

요한계시록 13장의 666짐승은 10개 뿔과 7개 머리를 가지고 있다.

666에서 10과 7

그러니까 666에서 17을 빼면

649가 나온다.

6곱하기4곱하기9 = 216

6곱하기6곱하기6 = 216

어떻게 이렇게 일치하는가? 이게 우연인가?




In the ancient magic book 'Zhouyi', 216 is Satan Lucifer who rules the air power.

144 is the number of the earth.

216 is Satan, the evil alien demons who rule the universe.

144 is the number of the earth.

If you add 216 and 144, you get 360.

고대 마법서 '주역(周易)'에서 216은 공중 세력을 지배하는 사탄 루시퍼를 뜻합니다.

144는 지구의 숫자입니다.

216은 우주를 지배하는 사악한 외계 악마, 사탄을 뜻합니다.

144는 지구의 숫자입니다.

216과 144를 더하면 360이 됩니다.









The total number of genes (novel SNVs) contained in the 23 pairs of normal human chromosomes is 144,000.

정상적인 인간 염색체 23쌍에 포함된 유전자(신규 SNV)의 총 수는 144,000개입니다.

Human DNA consists of 23 pairs of chromosomes. (Maybe Google Chrome stands for chromosomes?) Two of the pairs relate to gender: XY for men and XX for women. 

Excluding the sex chromosomes, the rest are called Basic 

Chromosomes or Autosomes and are made up of 22 pairs, or 22 x 2 rows = 44. Because it has two lines, it is called a ‘double helix structure’.

인간의 DNA는 23쌍의 염색체로 구성되어 있습니다. (아마도 Google Chrome은 

염색체를 의미할까요?) 쌍 중 두 개는 성별과 관련이 있습니다. 

남성의 경우 XY, 여성의 경우 XX입니다. 성염색체를 제외한 나머지를 기본염색체 또는

 상염색체라고 하며 22쌍, 즉 22×2줄 = 44개로 이루어져 있다. 2줄로 되어 있어 ‘이중나선구조’라 부른다.

Human DNA consists of 23 pairs of chromosomes. (Perhaps Google Chrome means chromosomes?) Two of the pairs are gender-related. XY for men and XX for women.

 Excluding the sex chromosomes, the remaining parts are called basic chromosomes or autosomes and consist of 22 pairs, or 22 x 2 rows = 44. 

Because it consists of two lines, it is called a ‘double helix structure’. 

Since there are 22 double helices in 2 rows, it can be expressed as 222.

 The triple helix is ​​322 (skull and bones).

However, the newly discovered fact is that the total number of genes (Novel SNV) 

contained in 23 pairs of normal human chromosomes is 144,000.

If you add one line to form a triple helix structure, the total number of genes is 

(divide by 2 and multiply by 3) to 216,000. This happens.

인간의 DNA는 23쌍의 염색체로 구성되어 있습니다.

 (아마도 Google Chrome은 염색체를 의미할까요?) 쌍 중 두 개는 성별과 관련이 있습니다. 

남자는 XY, 여자는 XX. 성염색체를 제외한 나머지 부분을 기본염색체 또는 상염색체라고 하며 22쌍, 즉 22×2행 = 44개로 구성되어 있다.

 2개의 선으로 이루어져 있어 ‘이중나선구조’라 부른다. 이중나선이 2줄로 22개 있으므로 222로 표현할 수 있다. 

삼중나선은 322(해골과 뼈)이다. 그러나 새로 밝혀진 사실은 정상 인간 염색체 23쌍에 포함된 유전자(Novel SNV)의 총 개수가 144,000개라는 것이다. 

한 줄을 더해 삼중 나선 구조를 이루면 전체 유전자 수는 (2로 나누고 3을 곱함) 216,000개가 됩니다. 

이런 일이 발생합니다.

Why is the triple helix structure important? The importance is also proven by numbers.

In the Bible, the number of the beast is six hundred and three score and six. That is, 

600, 60, and 6. Here, 'and' can be interpreted as multiplication rather than addition. 

So what about 600 * 60 * 6? 216,000. Therefore, the 666 mark of the beast that 

Christians have been talking about simply by adding up may actually be 216,000.

삼중 나선 구조가 왜 중요한가요? 그 중요성은 숫자로도 입증됩니다.

 성경에 나오는 짐승의 수는 육백삼십육입니다. 즉, 600, 60, 6입니다.

 여기서 '그리고'는 덧셈이 아닌 곱셈으로 해석될 수 있습니다. 그렇다면 600*60*6은 어떨까요?

 216,000. 그러므로 기독교인들이 단순히 합산해서 이야기해 온 짐승의 표 666은 실제로는 216,000이 될 수도 있다.


666, 216,000, both possibilities cannot be ruled out, but it seems very likely that the

 final game is the 'triple helix gene'. It's important to remain a person with 144,000 clean genes

666, 216,000, 두 가지 가능성 모두 배제할 수는 없지만, 최종 게임은 '삼중나선 유전자'일 가능성이 

매우 높아 보인다. 144,000개의 깨끗한 유전자를 가진 사람으로 남는 것이 중요하다



People who received COVID-19 fake mRNA vaccine. It can change to a triple helix structure and change to 216,000.

코로나19 가짜 mRNA 백신을 접종받은 사람들. 삼중나선구조로 변해 216,000으로 변할 수 있다.

There is something Rudolf Steiner said about 100 years ago. In the future, human souls will be removed by medicine. ​ Infants get vaccinated while pretending to be healthy. As a result, humans will no longer be able to recognize their souls. ​ ​ Currently, adults are vaccinated against certain diseases. In the future, children will not be able to survive mentally even after receiving vaccines... People who have been vaccinated may be smart, but they will not develop morality or conscience. But this is the goal of the materialists. Vaccination allows the recipient's etheric body to leave the body. Then the relationship between the soul and the universe becomes very unstable and mechanical. But the body must be perfected on earth through willpower and spiritual effort. Vaccines allow human consciousness to become fascinated with substances. Therefore, vaccinated humans continue to have materialistic thinking. And you cannot increase your spiritual consciousness by becoming like an animal. Demon possessed in human body

루돌프 슈타이너가 약 100년 전에 했던 말이 있습니다. 미래에는 인간의 영혼이 의학에 의해 제거될 것이다. ​ 영유아는 건강한 척 하며 예방접종을 받습니다. 그 결과 인간은 더 이상 영혼을 인식하지 못하게 될 것입니다. ​ ​ 현재 성인은 특정 질병에 대한 예방접종을 받고 있습니다. 앞으로 아이들은 백신을 맞고도 정신적으로 살 수 없을 것이다... 백신을 접종받은 사람은 똑똑할지 몰라도 도덕성이나 양심이 발달하지 못할 것이다. 그러나 이것이 유물론자들의 목표이다. 예방접종을 하면 수혜자의 에테르체가 몸 밖으로 나갈 수 있습니다. 그러면 영혼과 우주의 관계는 매우 불안정하고 기계적으로 변하게 됩니다. 그러나 육체는 의지력과 영적인 노력을 통해 지상에서 완성되어야 합니다. 백신은 인간의 의식이 물질에 매료되도록 해줍니다. 그러므로 예방접종을 받은 인간은 계속해서 물질주의적인 사고를 갖고 있습니다. 그리고 동물처럼 되어서 영적 의식을 높일 수는 없습니다. 인간의 몸에 사로잡힌 악마

Luc Montagnier, a 2008 Nobel Prize winner, published a paper (DNA Waves and Wate) in 2010 demonstrating that DNA is both a transmitter and receiver of frequencies. According to the paper, it was found that the DNA base sequences of bacteria or viruses in dilute aqueous solutions induce low-frequency electromagnetic waves. This means that DNA acts as an antenna.

2008년 노벨상 수상자 Luc Montagnier는 2010년에 DNA가 주파수의 송신기이자 수신기임을 입증하는 논문(DNA Waves and Wate)을 발표했습니다. 논문에 따르면, 묽은 수용액에 있는 박테리아나 바이러스의 DNA 염기서열이 저주파 전자기파를 유도하는 것으로 밝혀졌다. 이는 DNA가 안테나 역할을 한다는 뜻이다

When a synthetic mRNA (fake) vaccine was injected into the body, the body's DNA antennae were altered. As a result, the DNA antenna responds to artificial commands or commands from the control center. Conclusion: One of the goals of Operation COVID-19 is mass vaccination of (fake) coronavirus vaccines (synthetic agenda, nanotechnology agenda, smart grid agenda, etc.). The (fake) coronavirus vaccine is not just a gene therapy that is harmful to the body. … It is being used to make people infertile and reduce the population. Injecting these (fake) vaccines controls what information a person's DNA can access. As a result, it affects a person's cognition or perception. Mass vaccination with (fake) coronavirus vaccines is a large-scale strategy by the NWO to control human cognition and perception. ​ Our cognition or perception is determined by the information we receive.

합성 mRNA(가짜) 백신을 체내에 주사하면, 신체의 DNA 안테나가 변경되었습니다. 결과적으로 DNA 안테나는 인위적인 명령이나 관제센터의 명령에 반응하게 된다.

결론: 코로나19 작전의 목표 중 하나는 (가짜) 코로나바이러스 백신(합성 아젠다, 나노기술 아젠다, 스마트 그리드 아젠다 등)을 대량 접종하는 것입니다. (가짜) 코로나바이러스 백신은 단순히 신체에 유해한 유전자 치료법이 아닙니다. … 불임하게 만들고 인구를 줄이는 데 이용되고 있습니다. 이러한 (가짜) 백신을 주사하면 개인의 DNA가 접근할 수 있는 정보가 통제됩니다. 결과적으로 사람의 인지나 지각에 영향을 미치게 된다. (가짜) 코로나 백신을 대량 접종하는 것은 NWO가 인간의 인지와 지각을 통제하려는 대규모 전략이다. ​ 우리의 인지나 지각은 우리가 받는 정보에 따라 결정됩니다.


The second beast causes people to receive the mark of the beast (666) (Revelation 13:16-18).

The Samsung Republic appointed two Constitutional Court judges two days after offering a human sacrifice to Satan at Muan Airport.

The impeachment bill against Yoon Seok-yeol was passed in the second vote.

As expected, Yoon Seok-yeol was arrested in the second attempt.

It was clearly an imitation of the second beast, which garnered 666 votes.

In particular, the devil Lee Jae-yong, who took office as chairman of Samsung Electronics two days before the Itaewon massacre and Satanic human sacrifice incident, imitates the second beast that is said to give 666 votes in the Book of Revelation.

둘째 짐승은 사람들에게 짐승의 표를 받게 합니다(666)(계 13:16-18). 

삼성공화국은 무안공항에서 사탄에게 인간제물을 바친 지 이틀 만에 헌법재판관 2명을 임명했다. 

윤석열 탄핵소추안이 2차 표결에서 가결됐다. 

예상대로 윤석열은 2차 시도에서 검거됐다. 

그것은 분명히 666표를 얻은 두 번째 짐승의 모방이었다. 

특히 이태원 학살과 사탄 인간희생 사건 이틀 전 삼성전자 회장으로 취임한 악마 이재용은 요한계시록

에서 666표를 준다는 둘째 짐승을 흉내낸다.





According to the ancient magic book 'Zhouyi',

144 is the number that means earth. 144=9

216 means Satan, the evil alien demon that rules the universe.

216=9

144 is the number that means earth.

If you add 216 and 144, you get 360.

The earth is 360 degrees=3+6+0=9

고대 주술서 '주역(周易)'에 따르면,

144는 땅을 뜻하는 숫자입니다. 144=9

216은 우주를 지배하는 사악한 외계 악마, 사탄을 의미합니다.

216=9

144는 땅을 뜻하는 숫자입니다.

216과 144를 더하면 360이 됩니다.

지구는 360도입니다. 3+6+0=9



Chinese people's favorite numbers are 3, 6, 8, and 9.

중국인들이 가장 좋아하는 숫자는 3, 6, 8, 9입니다.


i symbolizes the sun and moon floating on the 9th numerical pillar of the alphabet. No matter how you cut it, its value can end in 9. This is mathematical evidence that humans are imprisoned on Earth, ruled by Satan Lucifer. Earth 360 degrees = 3 + 6 + 0 = 9

180 degrees = 1 + 8 + 0 = 9

90 degrees = 9 + 0 = 9

45 degrees = 4 + 5 = 9

22.5 degrees = 2 + 2 + 5 = 9

11.25 degrees = 1 + 1 + 2 + 5 = 9

5.625 degrees = 5 + 6 + 2 + 5 = 18 = 1 + 8 = 9

2.8125 degrees = 2 + 8 + 1 + 2 + 5 = 9

i는 알파벳의 9번째 숫자 기둥에 떠 있는 태양과 달을 상징합니다.

어떻게 자르든 그 값은 9로 끝날 수 있습니다.

이것은 인간이 사탄 루시퍼가 지배하는 지구 감옥에 갇혀 있다는 수학적 증거입니다.

지구

360도 = 3 + 6 + 0 = 9

180도 = 1 + 8 + 0 = 9

90도 = 9 + 0 = 9

45도 = 4 + 5 = 9

22.5도 = 2 + 2 + 5 = 9

11.25도 = 1 + 1 + 2 + 5 = 9

5.625도 = 5 + 6 + 2 + 5 = 18 = 1 + 8 = 9

2.8125도

= 2 + 8 + 1 + 2 + 5 = 9




"Precession" refers to the phenomenon in which the axis of rotation of a top gradually changes, and when the movement of the axis of rotation shows a different ratio from the direction of the axis along which the top rotates, the expression "ratio 3:2" can be used. 

What is shocking is that the ratio of galaxies in the universe rotating clockwise is 3:2 

Clear evidence that the universe precesses


"세차 운동"이란 팽이의 회전축이 점진적으로 변하는 현상을 말하며, 회전축의 움직임이 팽이가 회전하는 축 방향과 다른 비율을 보일 때 "3:2 비율"이라는 표현을 사용할 수 있습니다.

충격적인 것은 우주에서 시계 방향으로 회전하는 은하의 비율이 3:2라는 것입니다.

우주가 세차 운동한다는 명백한 증거


What's shocking is that the clockwise galaxy ruled by God is 3/2, the counterclockwise galaxy ruled by Satan Lucifer is 1/3, and our galaxy, where Earth is, is 1/3 counterclockwise.


충격적인 것은 신이 지배하는 시계 방향의 은하는 3/2이고, 사탄 루시퍼가 지배하는 반시계 방향의 은하는 1/3이고, 지구가 있는 우리 은하는 반시계 방향의 1/3이라는 것입니다.




The Illuminati numerology 13, symbolizing Satan Lucifer, is equal to 1/3, which is 0.3333333. This is why 33 is important to the Illuminati.


일루미나티 수비학에서 사탄 루시퍼를 상징하는 13은 1/3, 즉 0.3333333과 같습니다. 이것이 일루미나티에게 33이 중요한 이유입니다.

When calculating the merger ratio of Samsung C&T stocks and Cheil Industries stocks, several media outlets reported that Samsung C&T stocks are undervalued at 1/3 of Cheil Industries stocks.

삼성물산 주식과 제일모직 주식의 합병비율을 계산해 보면, 삼성물산 주식이 제일모직 주식의 1/3 수준으로 저평가돼 있다는 언론보도가 나왔다.

It is clear that 1/3 is between 0.3333 and 0.3334. 3 times 1/3 is 1, 3 times 0.3333 is 0.9999,

1/3은 0.3333과 0.3334 사이에 있는 것이 분명합니다. 1/3을 3번 곱하면 1이고, 0.3333을 3번 곱하면 0.9999입니다.




January 9, 2019 = Samsung Group Cheil Industries-YG Entertainment launch fashion brand Nonagon On January 9, 2019, just before the Burning Sun incident became serious, the collaboration suddenly ended. =

2+1+9+1+9

2019년 1월 9일 = 삼성그룹 제일모직-YG엔터테인먼트, 패션 브랜드 '노나곤' 론칭 2019년 1월 9일, 버닝썬 사태가 본격화되기 직전, 두 사람의 협업은 돌연 종료되었습니다. =

2+1+9+1+9




It's called Nonagon, and it's a shape (polygon) with nine sides and nine angles.

It's a word created by adding the prefix 'Nona-' meaning 9 to the suffix '-gon' meaning polygon.

It's called Enneagon, and you know that ennea is 9 in the Enneagram~~

It's a spherical shape.

If you connect all the corners of a spherical shape, it looks like the picture on the side.

There are nine muses in Greek mythology.

There are nine main gods in Egyptian mythology~.

In Korea, there is a legend about a fox with nine tails called the Gumiho.

구각(九角)이라고 하는데, 변이 9개, 각이 9개인 다각형입니다.

9를 뜻하는 접두사 '노나-'와 다각형을 뜻하는 접미사 '곤'을 붙여서 만든 단어입니다.

에니어그램에서 에니어는 9라는 것을 아시죠~~

구형이죠.

구형의 모든 모서리를 연결하면 옆면의 그림처럼 보입니다.

그리스 신화에는 9명의 뮤즈가 있습니다.

이집트 신화에는 9명의 주요 신이 있습니다~.

한국에는 구미호라고 불리는 꼬리가 9개 달린 여우에 대한 전설이 있습니다.





이 안에서 우리는 숨은 그림찾기를 해볼까요?








9 is a number that stands alone, but

9 and 3, and the repeated 3

There is a 3 hidden inside it. It's like a hidden ambition~

9는 홀로 존재하는 숫자지만,

9와 3, 그리고 반복되는 3은

그 안에 3이 숨겨져 있어요. 마치 숨겨진 야망 같아요~





The Quran consists of 114 chapters. Of these, 113 chapters, except for Chapter 9, all begin with the phrase “In the name of Allah, the Merciful, the Compassionate”...

<Why is there no beginning line in Chapter 9 of the Quran?>


쿠란은 114장으로 구성되어 있습니다. 그중 9장을 제외한 113장은 모두 "자비롭고 자비로우신 알라의 이름으로"라는 구절로 시작합니다.

<쿠란 9장에는 왜 시작 부분이 없나요?>



Why COVID-19?

 The Quran consists of 114 chapters (19 x 6). The total number of verses in the Quran, including all the unnumbered Bismillahs, is 6346 (19 x 334). The sum of 6346 is 19. Bismillah appears 114 times. The first verse, "Bismillah...", consists of 19 characters. The Quran consists of 114 suras, so 19 x 6. The total number of verses in the Quran is 6346 = 6+3+4+6=19.

왜 COVID-19일까요?

쿠란은 114장(19 x 6)으로 구성되어 있습니다. 번호가 매겨지지 않은 모든 비스밀라를 포함하여 쿠란의 총 절 수는 6346절(19 x 334)입니다. 6346의 합은 19입니다. 비스밀라는 114번 등장합니다.

첫 번째 절인 "비스밀라..."는 19개의 문자로 구성되어 있습니다. 쿠란은 114개의 수라(sura)로 구성되어 있으므로 19 x 6입니다. 쿠란의 총 절 수는 6346 = 6 + 3 + 4 + 6 = 19입니다.






half-youngest sister Lee Yun-hyeong, who was murdered by Samsung Electronics Chairman Lee Jae-yong Date of death November 19, 2005 =2+5+1+1+1+9=19= Why "Number 19"? covid-19? 

Why "Number 19"?

19: It has magical meaning. It is also a number symbolizing the Second Coming.

The number 19 is also a number used to cause events/accidents or make blood sacrifices based on the natural phenomenon of the sun and moon having the same cycle every 19 years.

Therefore, Satan's servants symbolize the number 19, signifying the ongoing human and blood sacrifices for Satan.

At the same time, they called themselves the high priests of Satan.

So Satan's servants use it as a kind of performance to remind themselves that Satan is their master.

이재용 삼성전자 회장에게 살해된 이복동생 이윤형 사망일 2005년 11월 19일 =2+5+1+1+1+9=19= 왜 '19번'인가? 

코로나 19? 왜 "19번"인가? ​ 

19: 마법 같은 의미가 있어요. 재림을 상징하는 숫자이기도 합니다. ​ 

19라는 숫자는 해와 달이 19년을 주기로 같은 주기를 갖는 자연현상에 기초하여 사건/사고를 일으키거나 피의 제사를 드리는 데 사용되는 숫자이기도 합니다. ​ 그러므로 사탄의 종들은 숫자 19를 상징하며, 이는 사탄을 위한 계속되는 인간과 피의 희생을 의미합니다. ​ 동시에 그들은 스스로를 사탄의 대제사장이라 불렀습니다. ​ 그래서 사탄의 종들은 그것을 사탄이 그들의 주인임을 스스로 상기시키기 위한 일종의 공연으로 이용합니다.



Why COVID-19? The Quran consists of 114 chapters (19 x 6). The total number of verses in the Quran, including all the unnumbered Bismillahs, is 6346 (19 x 334). The sum of 6346 is 19. Bismillah appears 114 times. The first verse, "Bismillah...", consists of 19 characters. The Quran consists of 114 suras, so 19 x 6. The total number of verses in the Quran is 6346 = 6+3+4+6=19.

왜 COVID-19일까요?

쿠란은 114장(19 x 6)으로 구성되어 있습니다. 번호가 매겨지지 않은 모든 비스밀라를 포함하여 쿠란의 총 절 수는 6346절(19 x 334)입니다. 6346의 합은 19입니다. 비스밀라는 114번 등장합니다.

첫 번째 절인 "비스밀라..."는 19개의 문자로 구성되어 있습니다. 쿠란은 114개의 수라(sura)로 구성되어 있으므로 19 x 6입니다. 쿠란의 총 절 수는 6346 = 6 + 3 + 4 + 6 = 19입니다.





The Constitutional Court opens on January 14, the first day of the impeachment trial. 114?

헌법재판소는 탄핵 재판의 첫 날인 1월 14일에 개원합니다. 114?



Why COVID-19?




The Islamic number 19 is associated with the energy of expansion and new beginnings

이슬람 숫자 19는 확장과 새로운 시작의 에너지와 관련이 있습니다.





In Islamic numerology, the number 19 represents the value of 'Wahed' (Arabic for "one").

For example, in the Islamic faith, the number 19 is mentioned in the Quran and is associated with the miraculous nature of the scripture. The numerical value of the word 'Allah' (God) in Arabic is 19, symbolizing strange energy.

이슬람 수비학에서 숫자 19는 '와헤드(아랍어로 "하나")'의 가치를 나타냅니다.

예를 들어, 이슬람 신앙에서 숫자 19는 쿠란에 언급되며 경전의 기적적인 본질과 연관됩니다. 아랍어로 '알라(신)'라는 단어의 숫자 값은 19이며, 이는 기묘한 에너지를 상징합니다.






Likewise, the number 19 is very important in the Baha'i faith. It is associated with the Baha'i calendar, which consists of 19 months and 19 days. This unique calendar system reflects the Baha'i faith in the unity and harmony of all religions and cultures. Moreover, the meaning of number 19 can be found in other fields such as science and mathematics. In chemistry, potassium, an element essential for life, has atomic number 19. Additionally, 19 is a prime number, indicating its indivisibility and uniqueness.

마찬가지로, 바하이 신앙에서는 숫자 19가 매우 중요합니다. 이는 19개월과 19일로 구성된 바하이 달력과 관련이 있습니다. 이 독특한 달력 체계는 모든 종교와 문화의 통합과 조화를 믿는 바하이 신앙을 반영합니다.

게다가 숫자 19의 의미는 과학, 수학 등 다른 분야에서도 찾아볼 수 있다. 화학에서 생명에 꼭 필요한 원소인 칼륨은 원자번호 19번을 갖고 있습니다. 또한 19는 소수로서 그 불가분성과 유일성을 나타냅니다.



2, 3, 5, 7, 11, 13, 17, 31, 37, 71, 73, 79, 97, 113, 131, 199, 311, 337, 373, 733, 919, 991, 1 0 19 − 1 9 9 10 19 −1 ​ (1111111111111111111) , 1 0 23 − 1 9 9 10 23 −1 ​ , 1 0 317 − 1 9 9 10 317 −1 ​ , 1 0 1031 − 1 9 9 10 1031 −1 ​ , ... If you look at the numbers that become the same when rearranged, the number that can be rearranged does not appear for a long time after 991, and then 19 1s appear in a row. 1 0 19 − 1 9 9 10 19 −1 ​ This is what comes out. This is because all rearrangeable prime numbers greater than 991 are repunite prime numbers.

2, 3, 5, 7, 11, 13, 17, 31, 37, 71, 73, 79, 97, 113, 131, 199, 311, 337, 373, 733, 919, 991,

1

0

19

1

9

9

10

19

−1

(1111111111111111111) ,

1

0

23

1

9

9

10

23

−1

,

1

0

317

1

9

9

10

317

−1

,

1

0

1031

1

9

9

10

1031

−1

, ...

재배열했을 때 서로 같아지는 수를 하나로 통일해서 보면, 991 다음에 재배열 가능 소수가 한참 동안 나오지 않다가 1이 19개 늘어선

1

0

19

1

9

9

10

19

−1

이 나오는 셈이다. 991보다 큰 재배열 가능 소수는 모두 레퓨닛 소수이기 때문.



Currently, the scope of the longitudinal safety zone varies by domestic airport. The distance from Muan Airport is 199M =199m=199=1+9+9=19 Illuminati Numerology

현재 종방향 안전지대의 범위는 국내공항별로 다양하다. 무안공항의 거리는 199M =199m=199=1+9+9=19 일루미나티 수비학


Muan Airport in South Jeolla Province, South Korea, uses one runway divided into '01', which operates to the north, and '19', which operates to the south, depending on the flight direction.

대한민국 전라남도 무안공항은 비행 방향에 따라 북쪽으로 운행하는 '01'과 남쪽으로 운행하는 '19'로 나누어 하나의 활주로를 사용한다.




In addition, a 2m high and 4m thick concrete mound at the end of Runway 01, which was pointed out as a factor in aggravating the scale of damage to the extent that 179 people died, was demolished and expansion work was carried out. So there was no concrete barrier on runway 01. And runway 01 is 300m longer. So why did they suddenly land in the middle of Runway 19 in the opposite direction and try to crash into the concrete barrier at full speed? The end of runway 19, where the accident plane landed, was not related to the expansion work, so a concrete barrier was laid and a hill was created by covering it with dirt to conceal it, but this was not taught to the plane captains. Eventually, a collision occurred, causing a large-scale disaster.

또한 179명이 사망할 정도로 피해 규모를 가중시키는 요인으로 지적된 01번 활주로 끝부분 높이 2m, 두께 4m의 콘크리트 마운드를 철거하고 확장공사를 진행했다.

그래서 01번 활주로에는 콘크리트 장벽이 없었습니다.

그리고 01번 활주로는 300m 더 길어요.

그렇다면 그들은 왜 반대 방향으로 갑자기 19번 활주로 중앙에 착지해 전속력으로 콘크리트 장벽에 충돌하려 했을까요?

사고 비행기가 착륙한 19번 활주로 끝부분은 확장 공사와 관련이 없어 콘크리트 방벽을 깔고 이를 은폐하기 위해 흙으로 덮어 언덕을 만들었으나 이를 기장들에게 가르치지 않았다.

결국 충돌이 일어나 대규모 재난이 발생했다





What was particularly shocking was that the landing gear went down on runway 01, where the first landing was scheduled.

If it had landed that way, everyone would have been safe.

However, suddenly folding the landing gear

Seen as evidence of terrorism

Then, in the opposite direction, it landed in the center of runway 19, halved the braking distance, ran at full speed toward the concrete barrier, and exploded right behind the plane.

It was a really big explosion.

It is suspected that there was a bomb inside the plane that exploded on impact.

Alternatively, a remotely controlled explosive device may have been planted.

특히 충격적이었던 것은 첫 착륙이 예정됐던 01번 활주로에서 랜딩기어가 내려갔다는 점이다. 그렇게 착륙했다면 모두가 안전했을 것입니다. 그런데 갑자기 랜딩기어를 접는다. 테러의 증거로 본다 그러다 반대 방향으로 19번 활주로 중앙에 착지해 제동거리를 절반으로 줄인 뒤 콘크리트 방벽을 향해 전속력으로 달려가 비행기 바로 뒤에서 폭발했다. 정말 큰 폭발이었죠. 비행기 내부에 충격으로 폭발한 폭탄이 있었던 것으로 의심됩니다. 또는 원격으로 제어되는 폭발 장치가 설치되었을 수도 있습니다.



Jeollanam-do Muan Airport opening date: November 8, 2007 = 2+7+1+1+8=19 Muan Airport promoted to international airport December 8, 2024 = 19 Illuminati numerology Muan Airport terror attack after 21 days

전라남도 무안공항 개항 날짜 2007년 11월8일=2+7+1+1+8=19

무안공항 국제공항 승격 2024년12월8일=19 일루미나티 수비학

half-youngest sister Lee Yun-hyeong, who was murdered by Samsung Electronics Chairman Lee Jae-yong Date of death November 19, 2005 =2+5+1+1+1+9=19= Why "Number 19"? covid-19? Why "Number 19"?

삼성전자 이재용 회장에게 살해당한 이복 여동생 이윤형  사망일 2005년 11월 19일 =2+5+1+1+1+9=19= 왜 "19번"인가요? 코로나19? 왜 "19번"인가요?

"Putting up a concrete wall is like a criminal act," aviation expert David

Rearmount told Britain's Sky News.

항공 전문가 데이비드 리어마운트는 영국 스카이 뉴스와의 인터뷰에서 "콘크리트 벽을 세우는 것은 범죄 행위와 같습니다."라고 말했습니다.

"19 concrete pillars are driven in" means that what looks like a pile of dirt at first glance is actually 19 concrete pillars driven in tightly. In other words, it means that the structure is much stronger and more solid than expected. For example, it is an expression that describes that the internal structure is supported more solidly than it appears on the outside, such as a localizer facility.


"콘크리트 기둥 19개가 박혀 있다"는 말은 언뜻 보기에 흙더미처럼 보이는 것이 사실은 콘크리트 기둥 19개가 촘촘히 박혀 있다는 것을 의미합니다. 다시 말해, 구조물이 예상보다 훨씬 더 강하고 견고하다는 것을 의미합니다. 예를 들어, 로컬라이저 시설처럼 내부 구조물이 겉보기보다 더 견고하게 지지된다는 것을 표현하는 표현입니다.




This world is a virtual world of zombies ruled by Satan Lucifer, and a matrix of fake education and fake knowledge created by the Illuminati.


이 세상은 사탄 루시퍼가 지배하는 좀비들의 가상 세계이며, 일루미나티가 만들어낸 가짜 교육과 가짜 지식의 매트릭스입니다.



If you add all the natural numbers from 1 to 36, you get 666. 666 is the 36th triangular number, which is the value obtained by adding all the numbers from 1 to 36.


1부터 36까지의 모든 자연수를 더하면 666이 됩니다. 666은 36번째 삼각수이며, 1부터 36까지의 모든 숫자를 더한 값입니다.

The word "beast" appears 36 times in the Book of Revelation. If you multiply 6 by 6, 

you get 36. If you add 6 to <36>, you get 42. The beast is said to have power for 42 months.


요한계시록에는 "짐승"이라는 단어가 36번 등장합니다. 6에 6을 곱하면 36이 되고, 36에 6을 더하면 42가 됩니다. 짐승은 42개월 동안 권세를 가진다고 합니다.






The second law of thermodynamics and the Buddhist concept of impermanence share a common thread. Both speak to the increasing nature of change and disorder, signifying the transience of the universe and life. The second law of thermodynamics describes the tendency for entropy (disorder) to increase in isolated systems, implying that over time, all phenomena, both the universe and humanity, will become disordered and face death and annihilation.

열역학 제2법칙과 불교의 무상(無常) 개념은 공통점을 가지고 있습니다. 둘 다 변화와 무질서의 증가된 본질을 말하며, 우주와 삶의 덧없음을 상징합니다. 열역학 제2법칙은 고립된 계에서 엔트로피(무질서)가 증가하는 경향을 설명하며, 시간이 지남에 따라 우주와 인류를 포함한 모든 현상이 무질서해지고 죽음과 파멸에 직면하게 됨을 암시합니다.


The Buddhist concept of impermanence emphasizes this change and impermanence, presenting the view that everything is constantly changing and impermanent. In particular, the Five Defilements (五濁惡世) symbolize the corruption and decline of the world, including death and the end of existence. The goal of Buddhism is to escape this chaotic world and pursue liberation.


불교의 무상 개념은 이러한 변화와 무상을 강조하며, 모든 것은 끊임없이 변화하고 무상하다는 관점을 제시합니다. 특히 (五濁惡世)는 죽음과 존재의 종말을 포함한 세상의 타락과 쇠퇴를 상징합니다. 불교의 목표는 이러한 혼란스러운 세상에서 벗어나 해탈을 추구하는 것입니다




In Buddhism, liberation, the ideal state of escaping the chaotic, cyclical material world ruled by Satan, is recognized as difficult to achieve in reality. Liberation means breaking free from the cycle of reincarnation and suffering, and it requires constant practice and effort. It is said that even Shakyamuni Buddha reached liberation only after countless previous lives.

불교에서는 사탄이 지배하는 혼돈스럽고 순환하는 물질 세계에서 벗어나는 이상적인 상태인 해탈을 현실에서 이루기 어려운 것으로 여깁니다. 해탈은 윤회와 고통의 굴레에서 벗어나는 것을 의미하며, 끊임없는 수행과 노력이 필요합니다. 석가모니 부처님조차도 무수한 전생을 거친 후에야 해탈에 도달했다고 합니다.

The biblical verse, "When desire has conceived, it gives birth to sin; and sin, when it is full-grown, gives birth to death," means that greed is the beginning of sin, and sin ultimately leads to death. Since no one is free from greed, we are all sinners. Eating other living things, whether plants or animals, is itself greed and sin. All humans are sinners.

"욕망이 잉태하면 죄를 낳고 죄가 장성하면 사망을 낳느니라"라는 성경 구절은 탐욕이 죄의 시작이며, 죄는 결국 사망으로 이어진다는 것을 의미합니다. 탐욕 없는 사람은 없으므로 우리는 모두 죄인입니다. 다른 생물, 즉 식물과 동물을 먹는 것 자체가 탐욕이며 죄입니다. 모든 인간은 죄인입니다. 

The forgiveness of sins through Jesus Christ is one of the core doctrines of the Christian faith. It states that the problem of human sin is resolved and salvation is achieved through Jesus Christ's sacrifice on the cross. In other words, while humans cannot resolve the problem of sin on their own, through the atonement of Jesus Christ, the price of sin is paid and our relationship with God is restored.


예수 그리스도를 통한 죄 사함은 기독교 신앙의 핵심 교리 중 하나입니다. 이는 예수 그리스도의 십자가 희생을 통해 인간의 죄 문제가 해결되고 구원이 이루어진다고 말합니다. 다시 말해, 인간은 스스로 죄 문제를 해결할 수 없지만, 예수 그리스도의 속죄를 통해 죄의 값이 지불되고 하나님과의 관계가 회복된다는 것입니다.



The words "Take up your cross and follow me" go beyond simply accepting suffering or sacrifice. They imply abandoning our own desires and selfishness, and striving to restore God's order through spiritual enlightenment, confronting the chaos and temptations of the world. In other words, they carry a profound meaning: we must reject the animalistic, subconscious, and instinctual way of life, and live a life of rationality and spiritual growth, breaking free from Satan's control and pursuing the kingdom of God.

"십자가를 지고 나를 따르라"라는 말씀은 단순히 고통이나 희생을 받아들이는 것을 넘어섭니다. 이는 우리 자신의 욕망과 이기심을 버리고, 영적인 깨달음을 통해 하나님의 질서를 회복하고자 노력하며 세상의 혼돈과 유혹에 맞서는 것을 의미합니다. 다시 말해, 이 말씀에는 심오한 의미가 담겨 있습니다. 우리는 동물적이고 잠재의식적이며 본능적인 삶의 방식을 거부하고, 이성과 영적 성장의 삶을 살며 사탄의 지배에서 벗어나 하나님 나라를 추구해야 합니다.


This passage also depicts the lives of those who pursue spiritual values and live differently from the values of the world dominated by Satan: the poor in spirit, the mourners, the meek, those who hunger and thirst for righteousness, the merciful, the pure in heart, the peacemakers, and those who are persecuted for righteousness' sake.


Salvation is for these people to receive forgiveness of sins and be guided by the truth of Jesus Christ, escaping the material world of chaos, death, and the end of the world dominated by Satan, and entering the kingdom of God.


이 구절은 또한 사탄이 지배하는 세상의 가치관과 다르게 영적인 가치를 추구하고 살아가는 자들의 삶을 묘사합니다. 심령이 가난한 자, 애통하는 자, 온유한 자, 의에 주리고 목마른 자, 긍휼히 여기는 자, 마음이 청결한 자, 화평하게 하는 자, 의를 위하여 핍박받는 자들입니다.


구원은 이러한 사람들이 죄 사함을 받고 예수 그리스도의 진리의 인도를 받아, 사탄이 지배하는 혼돈과 죽음, 세상의 종말이라는 물질 세계에서 벗어나 하나님 나라에 들어가는 것입니다.


Revelation 20:15 reads, "And anyone whose name was not found written in the Book of Life was thrown into the lake of fire." This verse implies that at the final judgment, those whose names are not found in the Book of Life will be cast into the lake of fire, symbolizing eternal destruction. Related to this, some argue that the end of the universe and Earth is as imminent as the death of humanity, and some scientists believe that the end could come sooner than expected due to the increase in entropy.


요한계시록 20장 15절은 "누구든지 생명책에 기록되지 않은 자는 불못에 던져지더라"라고 말합니다. 이 구절은 최후의 심판 때 생명책에 기록되지 않은 자들은 불못에 던져질 것이며, 이는 영원한 멸망을 상징한다는 것을 암시합니다. 이와 관련하여 어떤 사람들은 우주와 지구의 종말이 인류의 죽음만큼이나 임박했다고 주장하며, 일부 과학자들은 엔트로피 증가로 인해 종말이 예상보다 일찍 올 수 있다고 믿습니다.

While reincarnation may offer an opportunity for spiritual development before the Final Judgment, it also foreshadows the end of the universe, the Earth, and humanity. For the unsaved, the end of the material world and the demise of Satan will be imminent, and they will be cast into the "lake of fire" with no further opportunity for salvation. This perspective is often associated with certain interpretations of Christian eschatology, particularly those found in the Book of Revelation.

환생은 최후의 심판 전에 영적 발전의 기회를 제공할 수 있지만, 동시에 우주, 지구, 그리고 인류의 종말을 예고하기도 합니다. 구원받지 못한 자들에게는 물질 세계의 종말과 사탄의 멸망이 임박하여 더 이상 구원받을 기회 없이 "불못"에 던져질 것입니다. 이러한 관점은 기독교 종말론에 대한 특정 해석, 특히 요한계시록에 나오는 해석과 종종 연관됩니다.


Yes, the expression "pilgrims leaving the material world dominated by Satan and heading toward the kingdom of God" is a biblical metaphor, metaphorically representing the life of a believer. It signifies the image of a believer who, despite the temptations and difficulties of the world, presses forward with the hope of the eternal kingdom of God. In other words, it is a metaphor for the journey of a believer who regards worldly life as a temporary sojourner, living with the hope of eternal heaven.

네, "사탄의 지배를 받는 물질 세계를 떠나 하나님 나라를 향해 나아가는 순례자"라는 표현은 성경적 은유로, 신자의 삶을 은유적으로 표현합니다. 세상의 유혹과 어려움 속에서도 영원한 하나님 나라에 대한 소망을 품고 앞으로 나아가는 신자의 모습을 의미합니다. 다시 말해, 세상적인 삶을 잠시 머무는 나그네로 여기고 영원한 천국에 대한 소망을 품고 살아가는 신자의 여정을 은유적으로 표현한 것입니다.







지금 재생 중






Today's topic is the conditions for entering the kingdom of God as spoken of by Jesus Christ.

오늘의 주제는 예수 그리스도께서 말씀하신 하나님 나라에 들어가기 위한 조건에 관한 것입니다.



According to Jesus' teachings, the kingdom of God is not of this world (John 18:36). This means that the kingdom of God exists in a spiritual realm, separate from the material and tangible world. Jesus taught his disciples about a spiritual kingdom that does not belong to this world.

예수님의 가르침에 따르면, 하나님 나라는 이 세상에 속하지 않습니다(요한복음 18:36). 이는 하나님 나라가 물질적이고 만질 수 있는 세상과 분리된 영적인 영역에 존재한다는 것을 의미합니다. 예수님은 제자들에게 이 세상에 속하지 않는 영적인 나라에 대해 가르치셨습니다.




The conditions for entering the Kingdom of God, as Jesus Christ spoke of it, can be summarized into two main points. First, one must repent and have faith in Jesus Christ. Second, one must live a life of repentance, a life of rebirth. This means following the guidance of the Holy Spirit, turning away from sin, and living according to God's will.

예수 그리스도께서 말씀하신 하나님 나라에 들어가는 조건은 크게 두 가지로 요약할 수 있습니다. 첫째, 회개하고 예수 그리스도를 믿어야 합니다. 둘째, 회개의 삶, 즉 거듭남의 삶을 살아야 합니다. 이는 성령의 인도하심을 따라 죄에서 돌이켜 하나님의 뜻대로 사는 것을 의미합니다.


The second law of thermodynamics, increased carbon dioxide, and increased entropy could impact scenarios for the end of the universe and Earth, with some theories predicting an earlier-than-expected end. According to the second law of thermodynamics, the entropy of an isolated system always increases, implying that the universe progresses toward increasing disorder. The global greenhouse effect, such as increased carbon dioxide, accelerates entropy growth, and some theories predict this could hasten the end of the universe and Earth.


열역학 제2법칙, 이산화탄소 증가, 그리고 엔트로피 증가는 우주와 지구의 종말 시나리오에 영향을 미칠 수 있으며, 일부 이론은 예상보다 빠른 종말을 예측합니다. 열역학 제2법칙에 따르면, 고립계의 엔트로피는 항상 증가하며, 이는 우주가 점점 더 무질서해지는 방향으로 진행됨을 의미합니다. 이산화탄소 증가와 같은 지구 온실 효과는 엔트로피 증가를 가속화하며, 일부 이론은 이것이 우주와 지구의 종말을 앞당길 수 있다고 예측합니다.


The biblical verse, "Then when desire has conceived, it gives birth to sin; and sin, when it is full-grown, gives birth to death," signifies that desire is the beginning of sin, and that sin ultimately leads to death. This verse, found in James 1:15, implies that human desire, when conceived, leads to sin, and that sin, when it grows, leads to death. Here, "sin" goes beyond mere moral wrongdoing to refer to a fundamental problem that corrupts human nature and severing one's relationship with God.


"욕망이 잉태하면 죄를 낳고 죄가 장성하면 사망을 낳느니라"라는 성경 구절은 욕망이 죄의 시작이며, 죄가 궁극적으로 사망으로 이어진다는 것을 의미합니다. 야고보서 1장 15절에 나오는 이 구절은 인간의 욕망이 잉태되면 죄를 낳고, 죄가 자라면 사망으로 이어진다는 것을 암시합니다. 여기서 "죄"는 단순한 도덕적 잘못을 넘어 인간 본성을 타락시키고 하나님과의 관계를 단절시키는 근본적인 문제를 지칭합니다.


In Buddhism, liberation means breaking free from attachment, and this attachment has aspects similar to the concept of greed in Christianity.


While Christianity interprets greed as giving birth to sin, Buddhism sees attachment as the cause of suffering and suffering. Therefore, liberation means breaking free from this attachment and reaching a state of freedom.


Greed gives birth to sin, and one cannot enter the kingdom of God while still committing sin.


Sin is incompatible with the holiness of the kingdom of God.


One can enter the kingdom of God by receiving forgiveness of sin and salvation through Jesus Christ.


불교에서 해탈이란 집착에서 벗어나는 것을 의미하며, 이 집착은 기독교의 탐욕 개념과 유사한 측면을 지닙니다.


기독교는 탐욕을 죄의 산물이라고 해석하는 반면, 불교는 집착을 고통과 괴로움의 원인으로 봅니다. 따라서 해탈이란 이 집착에서 벗어나 자유로운 상태에 도달하는 것을 의미합니다.


탐욕은 죄를 낳으며, 죄를 짓는 한 하나님 나라에 들어갈 수 없습니다.


죄는 하나님 나라의 거룩함과 양립할 수 없습니다.


예수 그리스도를 통해 죄 사함과 구원을 받음으로써 하나님 나라에 들어갈 수 있습니다.




As you know, marrying singer Ailee requires qualifications. Not just anyone can marry Ailee.

Similarly, one must be qualified to enter the Kingdom of God. It's not a place just anyone can enter.

아시다시피 가수 에일리와 결혼하려면 자격이 필요합니다. 아무나 에일리와 결혼할 수 있는 건 아닙니다.

마찬가지로, 하나님 나라에 들어가려면 자격을 갖춰야 합니다. 아무나 들어갈 수 있는 곳이 아닙니다.

According to Jesus' teachings, the Kingdom of God is not of this world (John 18:36). This means that the Kingdom of God exists in a spiritual realm separate from the material, tangible world. While this world, dominated by Satan's dark matter, prioritizes money and material possessions, the Kingdom of God is a spiritual realm that does not require material possessions.


예수님의 가르침에 따르면, 하나님 나라는 이 세상에 속하지 않습니다(요한복음 18:36). 이는 하나님 나라가 물질적이고 만질 수 있는 세상과 분리된 영적인 영역에 존재한다는 것을 의미합니다. 사탄의 어둠의 물질이 지배하는 이 세상은 돈과 물질적 소유를 우선시하지만, 하나님 나라는 물질적 소유를 필요로 하지 않는 영적인 영역입니다.


In Jesus' teachings, the Kingdom of God exists in a spiritual realm distinct from the pursuit of material wealth or power in this world, and emphasizes spiritual values and love. While this world is dominated by animal instincts and materialism, the Kingdom of God emphasizes spiritual maturity and true love. In other words, the Kingdom of God is a realm that can be experienced through spiritual enlightenment and the practice of love.


예수님의 가르침에서 하나님 나라는 이 세상의 물질적인 부나 권력 추구와는 구별되는 영적인 영역에 존재하며, 영적인 가치와 사랑을 강조합니다. 이 세상이 동물적인 본능과 물질주의에 지배받는 반면, 하나님 나라는 영적 성숙과 참된 사랑을 강조합니다. 다시 말해, 하나님 나라는 영적 깨달음과 사랑의 실천을 통해 경험할 수 있는 영역입니다.


About 300 million years after the Big Bang, oxygen was discovered in galaxies in the early universe. This suggests that oxygen existed much earlier than expected in existing models of cosmic evolution.


Of course, the Big Bang theory is riddled with flaws and likely requires further revision.


빅뱅 이후 약 3억 년 후, 초기 우주의 은하에서 산소가 발견되었습니다. 이는 산소가 기존 우주 진화 모델에서 예상했던 것보다 훨씬 이전에 존재했음을 시사합니다.


물론 빅뱅 이론은 결함이 많으며 추가적인 수정이 필요할 가능성이 높습니다.


"The prince of the power of the air" is a biblical expression referring to Satan, the devil, and is referred to as "the prince of the power of the air" in Ephesians 2:2. Here, "air" refers not to the air we breathe, but to the celestial realm, the dark matter that dominates the universe. This expression confirms the evidence that Satan influences the Earth and human life, bringing spiritual darkness and chaos. This evidence is supported by evidence of disordered entropy growth, death, and the end of the world.


Contrary to conventional scientific theory, evidence has been found that oxygen existed from the beginning of the universe.

"공중의 권세 잡은 자"는 사탄, 곧 마귀를 가리키는 성경적 표현이며, 에베소서 2장 2절에서는 "공중의 권세 잡은 자"로 언급됩니다. 여기서 "공기"는 우리가 숨쉬는 공기가 아니라, 우주를 지배하는 암흑 물질인 천상의 영역을 가리킵니다. 이 표현은 사탄이 지구와 인간의 삶에 영향을 미쳐 영적인 어둠과 혼돈을 가져온다는 증거를 확증합니다. 이 증거는 무질서한 엔트로피 성장, 죽음, 그리고 세상의 종말에 대한 증거로 뒷받침됩니다.


기존 과학 이론과는 달리, 산소가 우주의 시작부터 존재했다는 증거가 발견되었습니다.


This book explains that Satan's deception drove humanity from the Kingdom of God and plunged it into a world dominated by Satan's dark matter.


Human greed and sin are linked to the Fall of Eden, and have brought suffering and trials upon humanity ever since.


However, we can only be saved by escaping this chaotic and disordered world, where greed leads to sin, and sin leads to death. This world is a disordered world, where entropy increases according to the second law of thermodynamics.


이 책은 사탄의 속임수가 인류를 하나님 나라에서 몰아내고 사탄의 암흑 물질이 지배하는 세상으로 몰아넣었다고 설명합니다.


인간의 탐욕과 죄는 에덴의 타락과 연결되어 있으며, 그 이후로 인류에게 고통과 시련을 안겨주었습니다.


하지만 우리는 탐욕이 죄로 이어지고 죄가 죽음으로 이어지는 이 혼돈스럽고 무질서한 세상에서 벗어나야만 구원받을 수 있습니다. 이 세상은 열역학 제2법칙에 따라 엔트로피가 증가하는 무질서한 세상입니다.



The conscious resistance to the chaos of the universe governed by Satan's dark matter and the unconscious, instinctive chaos that governs animal behavior is interpreted as a symbolic representation of the conflict and sacrifice that human reason and soul experience as they seek divine order, free from the dominion of instinct and desire. All entities controlled by Satan's power and capital—the police, prosecutors, courts, media, broadcasters, politicians, mafia, and violent organizations—act like the unconscious, instinctive forces that dominate animals, creating false laws and murdering those who resist the dictator.

사탄의 암흑 물질이 지배하는 우주의 혼돈과 동물의 행동을 지배하는 무의식적이고 본능적인 혼돈에 대한 의식적인 저항은 인간의 이성과 영혼이 본능과 욕망의 지배에서 벗어나 신의 질서를 추구하면서 겪는 갈등과 희생을 상징적으로 표현한 것으로 해석됩니다. 사탄의 권력과 자본에 지배받는 모든 존재들, 즉 경찰, 검찰, 법원, 언론, 방송사, 정치인, 마피아, 폭력 조직들은 마치 동물을 지배하는 무의식적이고 본능적인 세력처럼 행동하며, 거짓 법을 만들고 독재자에게 저항하는 자들을 살해합니다.





Among Samsung Group Chairman Lee Kun-hee's four siblings, a photo of Lee Yun-hyeong, the only one with his head tilted to the left, was circulated on the Internet.

이건희 삼성그룹 회장의 4남매 중 유일하게 왼쪽으로 고개를 기울인 이윤형 사진이 인터넷에 유포됐다.


This is evidence that the cunning devil Lee Jae-yong, Chairman of Samsung Electronics, tried to offer Lee Yun-hyeong as a human sacrifice to Satan from the beginning. 

Just as the Sewol Ferry sank to the left, why is Lee Yunhyeong’s photo tilted to the left?


이는 교활한 악마 이재용 삼성전자 회장이 처음부터 이윤형을 인간 제물로 바치려 했다는 증거다. 

세월호가 왼쪽으로 가라앉은 것처럼 이윤형 사진도 왼쪽으로 기울어져 있는 이유는 무엇일까?


Neutrinos have the property of rotating only to the left.


Satan, Lucifer, who rules the world over material things, uses the left side more.


중성미자는 왼쪽으로만 회전하는 성질을 가지고 있습니다.


물질로 세상을 다스리는 사탄, 루시퍼는 왼쪽을 더 많이 사용합니다.









There is a scene in the middle of the Gentleman music video where Psy shouts 'Wet Psy' while being hit by water, and this word can also be seen as a play on words reminiscent of 'West side'.  

 

For the Illuminati (Freemasons), 'West side' means the 'West side' of the Nile River in Egypt, their spiritual home.   The pyramids, the representative symbol of the Illuminati, are erected here. 


Gentleman 뮤직비디오 중간에 싸이가 물에 맞으면서 'Wet Psy'를 외치는 장면이 있는데, 이 단어는 'West Side'를 연상시키는 말장난으로도 볼 수 있다.  


일루미나티(프리메이슨)에게 '서쪽'은 그들의 정신적 고향인 이집트 나일강의 '서쪽'을 의미한다.   일루미나티의 대표적인 상징인 피라미드가 이곳에 세워져 있다.


When the Sewol Ferry sank, draining the port ballast tank and overloading rebar were confirmed to be one of the causes of loss of stability. In particular, the results of the investigation revealed that the lack of ballast water before departure raised the ship's center of gravity and caused the ship to tilt to port, increasing the possibility of an accident.



세월호 침몰 당시 좌현 밸러스트 탱크 배수, 철근 과적 등이 안정성 상실 원인 중 하나로 확인됐다. 특히 조사 결과 출항 전 평형수 부족으로 인해 선박의 무게중심이 높아지면서 선박이 좌현으로 기울어져 사고 가능성이 높아진 것으로 드러났다.




The angle of rotation during one cycle of precession is 360 degrees. Precession refers to the phenomenon in which the axis of rotation of a rotating object rotates in a cone shape around another axis. At this time, the time it takes for the rotation axis to rotate once is one cycle, and during this one cycle, the rotation axis rotates 360 degrees.

세차 운동의 한 주기 동안 회전 각도는 360도입니다. 세차운동이란 회전하는 물체의 회전축이 다른 축을 중심으로 원뿔 모양으로 회전하는 현상을 말합니다. 이때, 회전축이 1회전하는데 걸리는 시간은 1사이클이고, 이 1사이클 동안 회전축은 360도 회전하게 된다.

Rotate 360 degrees as the Earth rotates once a day

지구가 하루에 한 번 자전하면서 360도 회전합니다.

The twisted shape of DNA shows ‘rotational symmetry’. Even if you turn it 360 degrees, the same pattern repeats itself.

DNA의 뒤틀린 모양은 '회전대칭'을 나타냅니다. 360도 돌려봐도 같은 패턴이 반복됩니다.


The helical structure of DNA is a mathematically perfect geometric shape. This is called a ‘double helix’. 

The angles and spacing of this spiral are also very precise. Rotates approximately 36 degrees per rotation


DNA의 나선형 구조는 수학적으로 완벽한 기하학적 모양입니다. 이를 '이중 나선'이라고 합니다. 

이 나선의 각도와 간격도 매우 정확합니다. 1회전당 약 36도 회전



Your description of the Pyramids of Giza, Egypt is correct. The Giza Pyramids are located approximately 13 km from downtown Cairo. The entrance is twisted 3.6 degrees to the northeast and is located 13 stories high.


이집트 기자 피라미드에 대한 귀하의 설명이 정확합니다. 기자 피라미드는 카이로 시내에서 약 13km 떨어져 있습니다. 입구는 북동쪽으로 3.6도 비틀어져 있으며 높이는 13층이다.








The word "beast" appears a total of 36 times in the Book of Revelation, and 666 is the 36th triangular number, that is, the sum of all natural numbers from 1 to 36. Therefore, 666 can be said to be a triangular number among triangular numbers. 요한계시록에는 '짐승'이라는 단어가 총 36번 등장하는데, 666은 36번째 삼각수, 즉 1에서 36까지의 모든 자연수를 합한 수입니다. 따라서 666은 삼각수 중 삼각수라고 할 수 있습니다.


Trump shows a bruise on his right hand

오른손에 멍자국이 보이는 트럼프 



 



젠틀맨을 홍보하는 포스터에 13명의 싸이가 등장하고 있다. 




half-youngest sister Lee Yun-hyeong, who was murdered by Samsung Electronics Chairman Lee Jae-yong Date of death November 19, 2005 =2+5+1+1+1+9=19= Why "Number 19"? covid-19? Why "Number 19"?

 

Therefore, the servants of Satan symbolize the number 19, and it indicates the

continuation of human sacrifices and blood sacrifices for Satan.

At the same time, they call themselves the high priests of Satan.

So the servants of Satan use the number 19 as a kind of performance to remind themselves that Satan is their master.


이재용 삼성전자 회장에게 살해된 이복동생 이윤형 사망일 2005년 11월 19일 =2+5+1+1+1+9=19= 왜 '19번'인가? 코로나 19? 왜 "19번"인가?


그러므로 사탄의 종들은 숫자 19를 상징하며, 

사탄을 위한 인간 희생과 피의 희생이 계속됩니다.

​그리고 동시에 그들은 스스로를 사탄의 대제사장이라고 부릅니다.

그래서 사탄의 종들은 숫자 19를 사탄이 그들의 주인임을 상기시키기 위한 일종의 공연으로 사용합니다.




 



그림입니다.

원본 그림의 이름: IMG000028c838fd.png

원본 그림의 크기: 가로 16pixel, 세로 16pixel

한겨레

삼성 승계, 2014510'거사'

<Samsung succession process begins on May 10, 2014 = Hankyoreh

Newspaper>

Samsung Electronics' Cunning Demon, Lee Jae-yong's Hidden Card

Samsung Group Chairman Lee Kun-hee wasn't visible, but

Chairman Lee Kun-hee seemed to be able to see me through the screen.

He offered 100 billion won over a voice call. Lee Jae-yong warned me to be careful, saying he could kill Chairman Lee Kun-hee.

 



In the Riemann hypothesis, the sixth decimal place, 13, symbolizes the dragon and Satan. About ten days later, on May 10, 2014 = 2+1+4+5+1=13, news came out that Samsung Group Chairman Lee Kun-hee had lost consciousness. I was convinced that Chairman Lee Kun-hee had been assassinated. After that, the media and broadcasting companies that had pledged allegiance to the Republic of Samsung reported the false news that Chairman Lee Kun-hee of Samsung Group was alive as if it were true.

 

On May 10, 2014, about ten days after my phone call with Samsung Group Chairman Lee Kun-hee, news arrived that he had lost consciousness from an acute myocardial infarction. I was convinced he had been assassinated. This was about ten days before he collapsed. A secret agent sent by the chairman took me to a secret location. The chairman was not present; we only had a brief phone conversation.

 

 

At that time, the vice chairman of Samsung Electronics, Lee Jae-yong, a piece of evil trash, laid all kinds of dirty traps to kill me. In particular, many people know that there were attempts to socially isolate me by spreading false claims and rumors that I was gay, even though I am not. I found out that Lee Jae-yong, the son of Samsung Group Chairman Lee Kun-hee, laid these dirty traps and spread false information to kill me, and in return, Chairman Lee Kun-hee promised to give me 100 billion won.



Let's start with the story of meeting Mr. Lee Yoon-hyung in the United States. When filming a drama or movie ends, the set is dismantled and the extras leave. It is very likely that Asuka Restaurant also disappeared like that. Mr. Lee Yoon-hyung, the half-daughter of Samsung Group Chairman Lee Kun-hee, mostly meets with upper-class people.

Upper-class people

are relatively difficult to frame as scapegoats because they have a lot of money and receive a lot of legal help.

Samsung Electronics' cunning Jaeyong Lee planned to sacrifice wanderers like me. Asuka, a Japanese restaurant in North Carolina, was built like a drama or movie set and appears to have hired extras. A job advertisement waiting for someone like me. I saw a job advertisement in the Hankook Ilbo newspaper in New York, called, visited, and started working. It was a cunning plan to deceive Samsung Group Chairman Lee Kun-hee, whom Jae-yong Lee feared the most.

Samsung X-file July 22, 2005=2+5+7+2+2=18=666

Under Hong Seok-hyun and Lee Jae-yong's cunning instructions, the media and broadcasters intensively attacked Chairman Lee Kun-hee with a planned scenario.

The Samsung Electronics Chairman was receiving treatment at the Houston MD Cancer Center.

 

November 19, 2005=2+5+1+1+9=19 The demons who killed Yunhyeong Lee

If you hear the news of Lee Yunhyeong's death

Under the pretext that Chairman Lee Kun-hee's condition may worsen due to shock,

Because the news of Lee Yun-hyeong’s death was not delivered to Chairman Lee Kun-hee,

So I asked if it was true that I couldn’t attend Lee Yunhyeong’s funeral.



Samsung Group Chairman Lee Kun-hee did not answer questions about why he did not attend the funeral.

Charlotte, North Carolina, USA

There was a high-end restaurant about 40 minutes away by car from the bus terminal.

I worked there for about 10 days.

After an argument with the chef, I returned to New York, but I don't remember the exact location.

The restaurant was Asuka Japanese Restaurant, which serves sushi and kitchen dishes as its main menu.

I worked as a sushi assistant.

Samsung Electronics Chairman Lee Jae-yong's maternal uncle

Hong Seok-hyun is the vice president of the Asia branch of the Sambyeon Committee. Just as there is no need for a set after filming a drama or movie is over.

The Asuka Japanese restaurant may have been demolished as well.

They are good at fabricating events and leaving fake records, so it is possible that they deleted the Asuka Japanese restaurant from the documents.

 

The restaurant owner said he was from South Jeolla Province and his mother was Japanese. The chef said he sought asylum in the United States after participating in the democracy movement in the 1980s. I wasn't working in the kitchen because I was a sushi assistant. I worked at the restaurant's sushi bar.

 

At the time, there were a few waitresses, a sushi man, and myself as a sushi assistant in the restaurant. During busy times, the restaurant owner occasionally helped out at the sushi bar. The sushi bar's chief technician said he was from Arizona and a former Korean naval officer. And the restaurant kitchen had a chef and a few kitchen assistants. There were several part-time waiters and waitresses. It seemed like other people were working too.

 

 

 

There were three people, including a chef, a dishwasher, and a sushi assistant, in an accommodation about a 10-minute drive away from the restaurant. Of course, the room was a private room.

Then, suddenly, a Chinese restaurant opened in Dayton, Ohio, and he said he was there too.

He said he was here to help open the door. I heard that Asuka Restaurant here recently opened.

The chef said he is a veteran technician and specializes in helping new restaurants run properly.

I asked a few questions to see if it was the same Chinese restaurant I was in in Dayton, Ohio, and it turned out to be the same place.



But I didn't tell the chef that I had been working at a Chinese restaurant in Dayton, Ohio for about a week.

But now that I think about it, I think the chef at the time knew without me even having to tell him that I worked at a Chinese restaurant in Dayton, Ohio for a week. It seems like a force like dark matter had been tracking me since 2001 and created a scenario that eventually dragged me to Asuka Japanese Restaurant. Of course, I think Lee Jae-yong and his group from Samsung are behind it.

2001 Chicago Korean Information Magazine Job Advertisement Japanese Restaurant 'Shogun' in Little Rock, Arkansas

I called then and they asked me to come and work for them. It was a winter crisis when finding a job was difficult and money was running out. I arrived by Greyhound and called from a public phone, and they came to meet me at the bus terminal.

In 2001, there was a pay phone near the Greyhound bus terminal.



The person in charge, who looked over 50 years old at the time, was said to be from Busan and graduated from Seoul National University.

It was a huge restaurant with many teppanyaki tables.

I remember being there for less than a month and then leaving for another place. One day, the manager of Shogun Restaurant, a Busan graduate who graduated from Seoul National University, offered to take me to another restaurant in his car and buy me food. A person came and the person next to him seemed to know the manager well. When I first met him, I remember thinking it was strange that he asked me so many questions. After finishing our meal, we return to Shogun Restaurant.

 

On the way back from dinner, I didn't ask any questions,

but the Shogun manager suddenly spoke up.

The person sitting next to me at dinner was Mr. Lim, and the Shogun manager said he was very wealthy.

After that, I traveled around the United States and started working at a Japanese restaurant in Asuka, North Carolina, in 2002.

 

 

 

In 2001, I quit my job at Shogun Japanese Restaurant in Bill Clinton's hometown of Little Rock, Arkansas, after less than a month. Then one day in 2001, I went to work at a store run by a Korean in North Carolina, quit after one day, and left for New York.

However, in 2002, I heard some Korean employees at Asuka Japanese Restaurant figure it out and talk about it, and at the time, it was dark matter.

I couldn't understand it at all. I never told anyone about my past.

I even used pseudonyms. The place I worked never did an ID check.

At the time, I couldn't understand how they knew about my past and talked about it among themselves.

 

I think he sneaked into my dorm like a thief while I was working, searched my bag, and checked my ID.

In 2002, I worked at a Japanese restaurant in Aska, North Carolina for about 10 days, then quit and went back to New York.

At that time, I stayed at that restaurant for about 10 days and then left. A place that was almost used as a movie set Japanese restaurant ‘Asuka’ Lee Jae-yong, then vice chairman of Samsung Electronics, created a trap and had people like me and Lee Yun-hyeong meet at Asuka Japanese Restaurant. A hidden card that tied me up like a hidden card and tricked Samsung Group Chairman Lee Kun-hee into thinking that Lee Yun-hyeong committed suicide because he loved me.



Of course, the hidden card is the last and most important card to be played when all other plans fail.

When all other plans failed, the cunning devil Lee Jae-yong, Vice Chairman of Samsung Electronics, created a hidden card.

The devil Lee Jae-yong prepared a hidden card. He told Chairman Lee Kun-hee that Lee Yoon-hyung committed suicide because he loved me, a wanderer.

I had to become an unknown wanderer, an undiscoverable being. I believed that if the devil Lee Jae-yong zombies discovered me first and quietly killed me before Chairman Lee Kun-hee could find me, all secrets would be covered up.

 

At the time, Samsung Group Chairman Lee Kun-hee claimed he didn't know who I was and tried to find me to confirm the truth.

However, the cunning devil Lee Jae-yong seemed to believe that if he could easily find and kill me, the truth of the incident would be covered up forever.

I believe that the devil, Samsung Electronics' Lee Jae-yong, used all his power and money to conceal the truth of the incident,

manipulating and concealing Lee Yoon-hyung's immigration records and information.

 

The coroner's report only revealed visible pressure marks around the neck, but no clear evidence of suicide.

This is because a proper autopsy was not performed.

There is no clear evidence that Lee Yoon-hyung committed suicide, so the question of whether he was murdered remains open.

Lee Yoon-hyung's body was hastily cremated at a Won Buddhist funeral,

presumably in an attempt to conceal the evidence of murder.



The New York medical examiner's report only found visible signs of pressure around the neck,

but did not provide clear evidence to prove suicide.

Of course.

It is said that it takes at least 2-3 weeks to determine the cause of death through an autopsy.

Lee Yoon-hyung's body was cremated two days later.

Therefore, it is certain that an autopsy was not performed.

It is impossible for a medical examiner to immediately determine the cause of death through a visual examination alone.

However, all domestic newspapers and broadcasting companies, including the New York Times, distorted the truth and reported that Lee Yoon-hyung's suicide was confirmed.

 

<An autopsy to accurately determine the cause of death can take anywhere from 2-3 weeks to several months to announce the results, depending on the condition of the body, the type of autopsy, and the processing speed of the relevant institutions.>

 

Mr. Lee Yoon-hyung's funeral was held in New York, USA on the morning of November 22, 2005. The funeral was held in the Won-Buddhist style at dawn, and

he was cremated before the Won-Buddhist style funeral in the USA. Afterwards, the remains were transferred to Korea and placed in a cemetery near Samsung Everland.

The cremation funeral process can be broadly divided into cremation reservation and reception, cremation, ashes collection, and ashes placement (coffin, scattering, etc.). First, a cremation reservation is made, and cremation is performed at a cremation facility. After cremation, the ashes are collected, placed in an urn, and delivered to the bereaved family. Afterwards, the bereaved family can place the ashes in a columbarium or columbarium, or scatter the ashes.

Mr. Lee Yoon-hyung died on November 19, 2005, but public mourning was prohibited, and the funeral was held secretly three days later, on November 22.

They say he was cremated before the funeral, so does that mean his body was cremated two days later?

It's certain that no autopsy was performed.

 

The New York medical examiner's report only found visible signs of pressure around the neck,

but did not provide clear evidence to prove suicide.

Of course.

It is said that it takes at least 2-3 weeks to determine the cause of death through an autopsy.

Lee Yoon-hyung's body was cremated two days later.

Therefore, it is certain that an autopsy was not performed.

It is impossible for a medical examiner to immediately determine the cause of death through a visual examination alone.

However, all domestic newspapers and broadcasting companies, including the New York Times, distorted the truth and reported that Lee Yoon-hyung's suicide was confirmed.







Samsung Electronics initially announced Lee Yoon-hyung's death as a "traffic accident."

It was later reported as a suicide. Even more suspicious is the date of Lee Yoon-hyung's funeral, November 22, 2005. 2005-11-22 = 2+5+1+1+2+2 = 13. This number holds significant significance in Illuminati numerology and symbolizes Satan, dragons, and snakes.

 

The actual date of death of Samsung Group Chairman Lee Kun-hee was May 10, 2014 = 2+1+4+5+1 = 13. This number symbolizes Satan, dragons, and snakes in Illuminati numerology.

 

<November 22, 2005, MBC current affairs program 'PD Notebook'>

An episode titled "Suspicions of the Hwang Woo-suk Myth" aired.

It raises questions about the source of eggs used in embryonic stem cell research.>

 

The Hwang Woo-seok stem cell manipulation incident was used as a means to cover up suspicions about the death of Lee Yun-hyung, the youngest daughter of Samsung Group Chairman Lee Kun-hee.

In fact, the JoongAng Ilbo focused only on the Hwang Woo-suk case for over a month, causing confusion in Korean society.

It has been about 10 days since I had a voice call with Samsung Group Chairman Lee Kun-hee.

On May 10, 2014, I heard through the media and broadcast that Chairman Lee Kun-hee suddenly lost consciousness due to myocardial infarction.

 

The first card created by Samsung Electronics devil Lee Jae-yong was announced by Samsung.

They tried to cover up the truth by saying that Lee Yun-hyeong died in a car accident, but failed.

The second card Jaeyong Lee presented was Samsung’s announcement.

Lee Yun-hyeong committed suicide after opposing Shin Soo-bin's marriage.

About the relationship between Shin Soobin and Lee Yunhyeong

Samsung Group Chairman Lee Kun-hee also did not believe it because he knew it well.

Jaeyong Lee's last cunning hidden card

The one Jaeyong Lee prepared was me.Samsung Group Chairman Lee Kun-hee doesn’t know who I am.

He said he was trying to find me to find out the truth about the incident.

 

The cunning devil Lee Jae-yong tried to find me and kill me first.

 

Lee Jae-yong, the devil of the Samsung Republic, tried to kill me several times.

A trap was laid, but by the grace of Jesus Christ I was able to escape it.

After talking with Chairman Lee Kun-hee, the truth of the incident was finally revealed.

I'm in 2002

I met Yunhyeong Lee at a restaurant in North Carolina.

 

I saw a job advertisement in the JoongAng Ilbo or Hankook Ilbo newspapers.

 

When I called and said I wanted to work

 

The restaurant owner told me to come.

Take the Greyhound express bus from New York

Arrive in Charlotte, North Carolina in 2 days and 1 night.

I called the restaurant owner and told him I had arrived. boniface

He came to pick me up at the bus terminal.

 

He didn't check my ID. I used a fake name at the time. Anyway, in 2002

Most places I worked at didn't check ID.

 

 

 



 





 

 

<8021 Old NC 86, Chapel Hill, NC 27516 United States



Won Buddhism North Carolina Church Address - Reference - Samsung Group Religion Won Buddhism>

Samsung Electronics Chairman Lee Jae-yong's mother, Hong Ra-hee, is a devout Won-Buddhist believer. ▲ Won Buddhism in North Carolina, USA.

North Carolina Won Buddhism

It is located in North Carolina's Triangle Research Area, known as the final battlefield during the Civil War.

(Korean: Tritral Commission) Asia Branch Vice Chairman Hong Seok-hyun and Samsung Electronics Chairman Lee Jae-yong

Hong Seok-hyun's maternal nephew Lee Jae-yong

Seoul mayor wants to build Won-Buddhism symbol

Sangam-dong Sky Park Seoul Ring. picture

 



There were too many conspiracies and traps.

Samsung Chairman Lee Kun-hee was afraid of finding me and finding out the truth about the incident.

The devil Lee Jae-yong tried to find me first and kill me.

In the movie 'Speed'

I was bombarded with numerous attacks, as if it were a series of traps and attacks.

 

Behind the false rumors and dirty traps that have tormented me for a long time,

It was strange because I had no idea who was there.

By chance, I searched Samsung Group on the Internet and looked for family photos.

The face of Chairman Lee Kun-hee's youngest daughter, who committed suicide, is identical to the face of the woman seen at the Asuka restaurant in North Carolina, USA.

I intuitively felt that there was a huge conspiracy behind Lee Yunhyeong's death.

There was some power behind it.

 

Before that, I never thought about Samsung or had any interest in it.

However, since 2009, it has been confirmed that there is a major problem.

I started tracking down Lee Yunhyeong’s death and the people behind it.

Finally in 2014

The background was explained through a voice call with Chairman Lee Kun-hee.

Ten days have passed since the voice call with Chairman Lee Kun-hee ended.

The devil Lee Jae-yong killed Chairman Lee Kun-hee on May 10, 2014.

Lee Jae-yong, the devil who took over the Samsung Republic

 

As reporter Lee Sang-ho said on YouTube, Samsung is behind major accidents in Korea.

 

Lee Jae-yong and Lee Yun-hyeong have the same family, Hong Ra-hee, the same mother.

But their mother says it is different.

When I went to Asuka Japanese Restaurant in the United States in 2002,

There was a man who followed Lee Yunhyeong.

The restaurant owner sometimes called Subin and Yunhyeong by their first names.



 

November 19, 2005=2+5+1+1+1+9=19 Illuminati Numerology 19=3:00 AM

The media reported that the name of the person who first discovered Lee Yun-hyeong's body was Shin Soo-bin.

I think this is Subin, whom I saw at Asuka Japanese Restaurant in 2002.

 

In 2002, I went out the back door of Asuka Restaurant to smoke a cigarette.

<It seemed suspicious that a young man named Soobin was reporting Yunhyeong Lee’s movements to someone on his cell phone>

Soobin looked like a murderer disguised as a bodyguard.

 

According to the coroner's report, only visible signs of compression were found around Lee Yunhyeong's neck.

No clear evidence was presented to prove suicide.

This is because a proper autopsy was not performed.

Lee Yun-hyeong's body was quickly cremated at a Won-Buddhist funeral home, making DNA extraction impossible.

It appears that cremation was applied hastily to conceal evidence of murder.

 

<“At Munhwa Ilbo, we have seen the world through Samsung’s eyes, and of course we will continue to do so in the future.

Let's continue to do so in the future. Please help us. “We are a blood alliance.”



 

The most fundamental power that Samsung can use to 'control' the media is advertising.

"If we remove Samsung's advertising from the Chosun Ilbo, I wonder if the

Chosun Ilbo can survive. (The Chosun Ilbo) probably won't survive."

"Whether it's the political or economic department, it's impossible to take on

important positions like editor-in-chief or news director without falling out of

favor with Samsung. In particular, people with ties to Samsung often get

promoted in the prosecution and the courts. There are actually cases

where the relationship between the editor-in-chief and news director

with Samsung is not smooth and then quickly breaks off." While the

media was busy saving Samsung, the National Pension Service approved the

merger of Samsung C&T and Cheil Industries, despite predicting a loss of 300 billion won.>



<Culture Daily, Seeing the World Through Samsung's Eyes. Of course, It Will Continue to Do So>

<The Fact>, Controversy Over 'Reporter of the Month'









The reason why the devil Lee Jae-yong distributed fake hospital room photos of Samsung Electronics

Chairman Lee Kun-hee on June 2, 2015, and why he murdered Seoul Mayor Park Won-soon.

The devil Jae-yong Lee was extremely anxious that the Cheil Industries-Samsung C&T merger

approval would be canceled at the general shareholders' meeting on July 17, 2015.

MERS was intentionally spread through Samsung Hospital, causing chaos in Korea.

After the first MERS patient occurred on May 20, 2015, a fake photo of Chairman Lee Kun-hee's

hospital room was released on the Samsung Republic Zombie the Fact site on June 2, 2015.

 


The Illuminati Triad was formed on July 1, 1972 at the Rockefeller Mansion under the auspices of David Rockefeller (former chairman of the CFR). Hong Seok-hyun: He served as Vice Chairman of the Asia Pacific Committee from 2012 to 2019. Samsung Electronics Dirty Devil Lee Jae-yong Chairman



 

In 1909, a person believed to be a black child is shown being tied up and moved for ritual.

Bohemian Grove Satan

As the Molexin ritual continued for a while, fire flew in front of the owl statue along with the devil's scream and it fell, Satan

The evil ritual of human sacrifice to Molexin reaches its peak. Photo: Alex Jones





Alex jones immediately exposed this on his show program, and of course, interest was proven through hundreds of thousands of views on YouTube. Alex Jones also surprises and interviews Republican Congressman David Gergen, an important person who participated in this, and embarrasses him. That's right. The Bohemian groove ritual that made the Republican Party leader so embarrassed that he even ran away in anger later on was part of the MOLECH faith that had been handed down since ancient times. The MOLECH faith appears in the Old Testament of the Bible and was a very cruel custom in the Canaan region that involved sacrificing children to a god statue, setting it on fire, and letting it fall into the flames.

The Trilateral Society was organized at the Rockefeller Mansion on July 1, 1972, under the patronage of David Rockefeller (former CFR president). Seok-Hyeon Hong: He served as vice-chairman of the Asia-Pacific Committee from 2012 to 2019. Samsung Electronics Devil member Chairman Lee Jae-yong

Photo Caption: History of the Sambyeonhoe Logo

 




You need to know about the Trilateral Commission. The abbreviation for the Triangular Committee is called Sambyeonhoe. The English spelling is ‘Trilateral Commission’. This organization was founded by David Rockefeller (President of Chase Manhattan Bank), the youngest of the four Rockefeller brothers, a member of the Illuminati, and was formed by members of the American, Japanese, and European parliaments, business community, academia, and media. Just as you can see the number 666 on the Rockefeller Building in New York, Rockefeller used 666 as the logo (mark) of the Trilateral Committee in the early days.

 

However, as controversy arose in some quarters, the number 666 was slightly modified and the current logo (666) was used. Even today, the Rockefeller Building has a neon sign with the number 666.

The triangular committee consists of the European Group, North American Group, and Pacific Asia Group. There is a Pacific Asia Group, and Samsung Electronics Chairman Lee Jae-yong is also a member.

An owl was used in the logo of Family Express, operated by JoongAng Ilbo. The owl is the logo of Bohemian Grove and a symbol of Molexin, the symbol of Satan's human sacrifice. In the case of Samsung, there are places where pyramids are built.





Meeting of pro-Moon Jae-in core forces The group name is ‘Owl’.



The ‘owl group’ protecting Moon Jae-in is causing controversy.

Source: Media Today (https://www.mediatoday.co.kr)

Hong Seok-hyun, Samsung Electronics Chairman Lee Jae-yong's maternal uncle, received a master's degree in industrial engineering and a doctorate in economics from Stanford University in the United States. He worked as an economist at the World Bank (IBRD) from 1977 to 1983 and as a research fellow at the Korea Development Institute (KDI) from 1985 to the following year.



In 1994, Hong Seok-hyun, vice president and CEO of JoongAng Ilbo, took office. He was promoted to president in March of the following year, and became chairman of JoongAng Ilbo in 1999.

 

 

A fire broke out at the Aricel factory, a partner of Samsung SDI.







That day, temporary captain Lee Jun-seok was drunk with a Filipino woman and did not participate in the ferry's operation.

With only an elementary school education, temporary captain Lee Jun-seok was a prepared scapegoat.

The court, which placed all responsibility on temporary captain Lee Jun-seok, sentenced him to life imprisonment.

The identity of first mate Shin Jeong-hoon, who joined the Sewol the day before the sinking, is a mystery.




The face of Kang Won-sik, the 44-year-old first mate of the Sewol ferry massacre.

There was no COVID-19 in 2014, so why are you wearing a mask?

The person wearing the mask in the photo claims to be 44-year-old first mate Won-sik Kang, but he is a different person.

The difference in appearance between youth and old age is clear.

The man wearing the mask is Shin Jeong-hoon (34), a National Intelligence Service agent under Samsung.

As a secret agent, his name and identity change frequently.

At the time, there were two first mates on board the Sewol ferry. Kang Won-sik (44) and first mate Shin Jeong-hoon (34).

The person below without a mask was the fake Shin Jeong-hoon, who had been replaced at the detention center.



The lower left claims that the man wearing the mask was a bodyguard at the time of the death of former President Roh Moo-hyun in 2009.



Suspicion is spreading that Shin Jeong-hoon, who was present as a witness to the Sewol Ferry's Certificate of Audit, was not Shin Jeong-hoon, the first mate of the Sewol ferry, who was arrested by the police at the beginning of the incident.

In particular, the fact that the shape of the ears of these two is significantly different proves that Shin Jung-hoon, who even appears in the testimony of the National Assembly, is a fake Shin Jeong-hoon who is acting as a substitute for the real Shin Jeong-hoon.

There are many suspicions that Shin Jung-hoon is a member of the secret organization of the National Intelligence Service.Samsung Republic

 

Sewol Ferry Disaster, April 16, 2014 = 2+1+4+4+1+6=18=666

Most of the Danwon High School students who went on a field trip to Jeju Island on the Sewol Ferry were 18 years old. In other words, 6+6+6=18.

Samsung Electronics, a partner of the Illuminati, aims to leave behind evidence of Illuminati numerology.

Samsung Electronics Chairman Lee Jae-yong providing Satan with numerological evidence that Samsung was behind the Sewol Ferry Disaster is like an office worker stamping his attendance card to receive his paycheck.







As my writing became known on the Internet, Lee Jae-yong, who directed a detention show to deceive the world in order to save Samsung Electronics.

On April 16, 2014, Samsung Electronics Vice Chairman Lee Jae-yong sacrificed 304 Sewol ferry passengers to Satan Lucifer and sent a signal to the Illuminati to pray for material blessings and protection of Samsung Electronics through Satan's protection.

Lee Jae-yong, vice chairman of Samsung Electronics, is the owner of the Samsung Republic, who chooses court detention to deceive the world and sets the date for entering the detention center and parole.

The Ministry of Justice is demanding the parole of Lee Jae-yong, vice chairman of Samsung Electronics.

The system was changed to drastically lower the parole threshold from 80% to 60%.

March 19, 2021 After being admitted to a special room at Samsung Hospital

He was released on parole on August 13, 2021.


내 글이 인터넷에 알려지자 삼성전자를 구하기 위해 세상을 속이는 구금쇼를 연출한 이재용.

이재용 삼성전자 부회장은 2014년 4월 16일 세월호 승객 304명을 사탄 루시퍼에게 제물로 바치고 일루미나티에게 사탄의 가호를 통해 삼성전자의 물질적 축복과 보호를 기원하라는 신호를 보냈다.

이재용 삼성전자 부회장은 세상을 속이기 위해 법원 구금을 선택하고, 구치소 입소 날짜와 가석방 날짜를 정하는 삼성공화국의 주인이다.

법무부가 이재용 삼성전자 부회장의 가석방을 요구하고 있다.

가석방 기준을 80%에서 60%로 대폭 낮추도록 제도가 바뀌었습니다.

2021년 3월 19일 삼성병원 특실 입원 후

그는 2021년 8월 13일에 가석방되었습니다.




There are claims that Samsung Electronics Chairman Lee Jae-yong was only seen leaving the detention center during the trial, but was actually in a secret hideout.

They say that if Samsung Electronics fails,

Korea will also fail.

Samsung Republic occupied Korea

 

The Sewol ferry incident occurred on April 16, 2014, which corresponds to 2+0+1+4+4+1+6=18=6+6+6=666 in numerology.

The salvage date of the Sewol ferry also corresponds to 2+0+1+7+3+2+3=18=6+6+6=666 of March 23, 2017.

The date of the sinking of the Sewol on the morning of April 16 is the same as the date of the sinking of the Titanic on April 15 in the United States, known as Semiramis' birthday.


이재용 삼성전자 회장이 재판 도중 구치소를 떠나는 모습만 목격됐을 뿐 실제로는 비밀 은신처에 있었다는 주장도 있다.

삼성전자가 망하면

한국도 실패할 것이다.

삼성공화국이 한국을 점령했다.


세월호 사건은 2014년 4월 16일에 발생했는데, 이는 수비학적으로 2+0+1+4+4+1+6=18=6+6+6=666에 해당합니다.

세월호 인양일자 역시 2017년 3월 23일의 2+0+1+7+3+2+3=18=6+6+6=666에 해당한다.

4월 16일 오전 세월호가 침몰한 날짜는 세미라미스의 생일로 알려진 미국의 4월 15일 타이타닉호 침몰 날짜와 동일하다.




 This is how the Sewol ferry massacre was carried out like this

What happened on April 15, 2014 (the day before the Sewol ferry accident)?

1. If the captain of a ship is unable to perform his duties in an unavoidable area, the first mate of the ship shall perform his duties on his behalf.

2. Danwon High School's contract was changed from the Ohanama Line to the Sewol ferry.

3. The contract for boarding the Sewol ferry for Seoul Myeonmok High School students has been cancelled. Temporary captain Lee Jun-seok on board is a temporary worker.

4. The Sewol ferry captain went on vacation and was replaced by interim captain Lee Jun-seok. Joined with 1st mate Shin Jeong-hoon.

5. Out of 10 ships scheduled to depart from Incheon Port in the thick fog, only the Sewol departed.


세월호 참사는 이렇게 진행됐다.

2014년 4월 15일(세월호 사고 전날)에는 무슨 일이 일어났는가?

1. 선장이 부득이한 지역에서 직무를 수행할 수 없을 때에는 그 선박의 일등항해사가 그 직무를 대행한다.

2. 단원고교의 계약이 오하나마선에서 세월호로 변경되었습니다.

3. 서울면목고등학교 학생들의 세월호 승선계약이 해지되었습니다. 승선한 임시선장 이준석은 임시직 근로자다.

4. 세월호 선장은 휴가를 떠나 임시 선장 이준석으로 교체됐다. 1등 항해사 신정훈과 합류.

5. 짙은 안개 속에서 인천항을 출발할 예정이었던 선박 10척 중 세월호만 출발했다.



The photo below shows the reason why the vice principal of Danwon High School, who knew best why the reservation for the relatively safe 'Ohamaho' was suddenly changed to the Sewol, which was at high risk of sinking, died.

아래 사진은 비교적 안전했던 '오하마호'의 예약이 갑자기 침몰 위험이 높은 세월호로 변경된 이유를 가장 잘 알고 있던 단원고 교감이 사망한 이유를 보여준다.


The Mokpo Coast Guard in South Jeolla Province is suspected of murdering the vice-principal of Danwon High School, who had direct knowledge of the evidence, and then masking it as a suicide.

The Mokpo Coast Guard in South Jeolla Province is suspected of murdering the vice-principal of Danwon High School, who had direct knowledge of the evidence, and then masking it as a suicide.

During the Sewol ferry sinking, draining the port ballast tank and overloading it with rebar were identified as one of the causes of the loss of stability. In particular, the investigation found that the ship's center of gravity was raised and the ship tilted to the port side due to the insufficient ballast water before departure, which increased the likelihood of the accident.


전남 목포 해경은 증거물을 직접 알고 있던 단원고 교감을 살해한 뒤 자살로 위장한 혐의를 받고 있다.

전남 목포 해경은 증거물을 직접 알고 있던 단원고 교감을 살해한 뒤 자살로 위장한 혐의를 받고 있다.

세월호 침몰 당시 좌현 밸러스트 탱크를 배수하고 철근을 과적하는 것이 안정성 상실의 원인 중 하나로 확인됐다. 특히 조사 결과, 출발 전 평형수 부족으로 선박의 무게중심이 높아지고 선박이 좌현으로 기울어져 사고 가능성이 높아진 것으로 드러났다.




 

On that day, at 8:46 on April 16, 2014, more than an hour had passed since the start of the atrocities. The cargo including heavy reinforcing bars at the top did not roll to the side as expected due to the sudden inclination that would occur after filling the empty ballast tank on the left and draining the right side, so overturning and blocking of the resilience did not occur at the same time, and flooding could not proceed.

A full speed/right swipe was carried out at 8:46, and this was a measure aimed at shifting the cargo to the left by centrifugal force. After 4 minutes of the circular sailing on the right side, the rebar (420 tons) was settled, and at this time, the roar of the container box and the cargo falling over would have been felt as a crash sound. proceeded.

Video footage showing the Coast Guard tying ropes to the upper part of the Sewol ferry, causing seawater to surge in, has been removed from the internet. The Coast Guard's claim that they only tied ropes and did not tow the ferry is unbelievable.


이날, 2014년 4월 16일 8시 46분, 잔학행위가 

시작된 지 한 시간 이상이 지났다. 상부의 무거운 

철근을 포함한 화물은 좌측의 빈 발라스트 탱크를 

채우고 우측의 배수를 한 후 발생하는 급격한 기울어짐

으로 인해 예상대로 옆으로 굴러가지 않아 전복과 

복원력의 막힘이 동시에 발생하지 않아 침수가 진행되지 않았다.


8시 46분에 전속/우측 스와이프를 실시했는데, 이는 

원심력에 의해 화물을 왼쪽으로 이동시키기 위한

 조치였다. 4분간 우측 원형 항해를 한 후 철근

(420톤)이 안착됐는데, 이때 컨테이너 박스의 

굉음과 화물이 넘어지는 소리가 충돌음으로 

느껴졌을 것이다. 진행되었습니다.


해경이 세월호 상부에 밧줄을 묶어 바닷물이 범람하는 

영상이 인터넷에서 삭제됐다. 밧줄만 묶었을 뿐 

여객선을 예인하지 않았다는 해경의 주장은 믿기지 않는다.











Rep. Roh Hoe-chan, who exposed the Samsung X-files to the media, said, "If a thief jumps over a wall and shouts 'I am a thief,' the police will not investigate properly." He added, "It's like the police protesting, asking if you saw the thief stealing, and then making the absurd claim that former Rep. Roh Hoe-chan defamed the thief."


The Samsung X-Files is a video that shows how Samsung bribed major presidential candidates, politicians, and prosecutors. The true nature of the bribe takers has had a great impact on Korean society.



삼성 엑스파일을 언론에 폭로한 노회찬 의원은 "도둑이 담을 뛰어넘어 '나는 도둑이다'라고 외치면 경찰이 제대로 수사하지 않는다"고 말했다. 이어 “경찰이 도둑이 물건을 훔치는 것을 봤느냐고 항의한 뒤 노회찬 전 의원이 도둑의 명예를 훼손했다고 황당한 주장을 하는 것과 같다”고 덧붙였다.


삼성 엑스파일은 삼성이 주요 대선후보와 정치인, 검사들에게 뇌물을 제공한 과정을 담은 영상이다. 뇌물수수자의 실체는 한국 사회에 큰 영향을 미쳤다.


 

However, the person who gave and received the bribe was not indicted, while MBC reporter Lee Sang-ho, who exposed the incident, and Representative Roh Hoe-chan, who urged a prosecution investigation, were indicted. The prosecution, which should have caught the thief, instead indicted the innocent citizen who reported the thief. The Supreme Court deemed the Samsung X-Files a private secret that needed to be protected and found them guilty of disclosing it to the public.

 

그러나 뇌물을 주고받은 사람은 기소되지 않았고, 사건을 폭로한 MBC 이상호 기자와 검찰 수사를 촉구한 노회찬 의원은 기소됐다. 도둑을 잡았어야 할 검찰은 도둑을 신고한 무고한 시민을 대신 기소했다. 대법원은 삼성 엑스파일을 보호받아야 할 개인기밀로 보고 이를 공개한 것에 대해 유죄를 선고했다.

In this case, the Supreme Court found Representative Roh Hoe-chan guilty of violating the Communications Secrets Protection Act. The Samsung chairman who ordered the bribe, the executive who conspired to receive it, the person who delivered it, and the prosecutor who accepted it are all innocent victims. On the other hand, I, who urged their investigation, am the perpetrator and qualified to be a member of the National Assembly. How is this any different from medical malpractice in lung cancer surgery, which involves removing a healthy stomach while leaving the cancerous lung intact?


이 사건에서 대법원은 노회찬 의원에게 통신비밀보호법 위반 혐의로 유죄를 선고했다. 뇌물을 지시한 삼성 회장, 뇌물을 공모한 임원, 전달한 사람, 받은 검사 모두 무고한 피해자다. 반면에 수사를 촉구한 나는 가해자이고 국회의원 자격도 있다. 이것이 암이 발생한 폐는 그대로 두고 건강한 위를 제거하는 폐암 수술의 의료과오와 어떻게 다른가?

Hwacheon Daeyu was exposed just before Rep. Lee Nak-yeon, a presidential candidate, lost to Rep. Lee Jae-myung in the Democratic Party primary.

If former Prime Minister Lee Nak-yeon had not exposed it, no one would have believed it.

Are there other financial frauds like Hwacheon Daeyu? It is estimated that there are more than ten.

The truth will never be revealed. The branches will just be cut off.

Lee Yong-shik, a professor of head and neck surgery at Konkuk University, appeared on an Internet broadcast and publicly raised the 'Roh Hoe-chan murder theory'.

In the case of Rep. Hoe-chan Roh, Professor Lee Yong-sik said, “If you jump over it, you have to be about 1m away from the building, but it is surprising that the body was found 7~8m away. He also argued that "external force that grabs limbs and throws them away can intervene in this street." "If a living person jumps, the surrounding area will become a 'sea of​​blood'." Less blood is nonsense."


화천대유는 민주당 경선에서 대선후보 이낙연 의원이 이재명 의원에게 패하기 직전에 폭로됐다.


이낙연 전 총리가 폭로하지 않았다면 누구도 믿지 않았을 것이다.


화천대유 같은 금융사기 또 있나요? 10개 이상인 것으로 추정된다.


진실은 결코 밝혀지지 않을 것입니다. 가지가 잘려질 뿐입니다.


이용식 건국대 두경부외과 교수가 인터넷 방송에 출연해 '노회찬 살인설'을 공개적으로 제기했다.


노회찬 의원의 경우 이용식 교수는 "뛰어넘으면 건물에서 1m 정도 떨어져야 하는데 시신이 7~8m 떨어진 곳에서 발견됐다는 게 놀랍다"며 "팔다리를 잡아 던지는 외력이 이 거리에 개입할 수 있다"고 주장하며 "살아있는 사람이 뛰어내리면 주변이 '피바다'가 된다"고 주장했다. 피가 적으면 말도 안 된다"고 주장했다.


(Conspiracy theories arose because CCTV footage of Roh Hoe-chan's last moments was not released.)

There's a law requiring an autopsy if no one saw him, but Roh Hoe-chan's body wasn't autopsied.

Lee Jae-yong's money was sent to Choi Soon-sil through Hana Bank.

President Park Geun-hye, who received nothing, protested the unfairness, but was impeached for her close relationship with Choi Soon-sil.

(The phrase "hidden power" was changed from "given by Samsung" to "received by Choi Soon-sil.")

Reporter Bang Hee-kyung, Sogang University Institute of Media and Culture

Hwacheon Daeyu Financial Fraud Asset Management is the same force as Semo Group Asset Management, which sacrificed its life to Satan, who took the lives of 304 people on the Sewol Ferry.

Busan Savings Bank is also involved in financial fraud. Behind it is the shadow government of South Korea, Samsung Republic.

The National Pension Service, a public corporation, was also effectively under the control of Samsung Republic.


(노회찬의 마지막 순간이 담긴 CCTV 영상이 공개되지 않아 음모론이 불거졌다.)


본 사람이 없으면 부검해야 한다는 법이 있는데 노회찬의 시신은 부검되지 않았다.


이재용의 돈은 하나은행을 통해 최순실씨에게 전달됐다.


아무것도 받지 못한 박근혜 대통령은 억울함을 항의했지만 최순실 씨와의 친분 때문에 탄핵됐다.


('숨겨진 힘'이라는 표현이 '삼성이 줬다'에서 '최순실이 받았다'로 바뀌었다.)


서강대학교 미디어문화연구소 방희경 기자


화천대유금융사기자산운용은 세월호에서 304명의 목숨을 앗아간 사탄에게 목숨을 바친 세모그룹자산운용과 같은 세력이다.


부산저축은행도 금융사기에 연루됐다. 그 뒤에는 대한민국의 그림자 정부인 삼성공화국이 있다.



공기업인 국민연금도 사실상 삼성공화국의 통제하에 있었다.



Former Coast Guard Chief Kim Seok-gyun was caught lying about deploying 500 divers. I think this is evidence that they intended to commit massacre and human sacrifice rather than rescue from the beginning.

김석균 전 해경청장이 잠수부 500명을 배치했다는 거짓말을 하다 적발됐다. 이는 처음부터 구출보다는 학살과 인간 제물을 저지르려는 의도가 있었다는 증거라고 봅니다.




Former Coast Guard Commissioner Kim Seok-kyun drew the ire of victims' families with his absurd, almost pun-laden, response at the Sewol ferry hearing.

Appearing as a witness on the second day of the hearing hosted by the Sewol Special Investigation Committee, former Commissioner Kim Seok-kyun responded to criticism that he had inflated the number of rescue workers at the time of the Sewol ferry disaster to around 500. He stated, "That means we mobilized that many people from across the country. It doesn't mean they all went underwater.“

On the day of the Sewol ferry disaster, civilian divers arrived at the scene but received no rescue orders from the Coast Guard. Furthermore, the Coast Guard Rescue Command meeting only issued instructions for the Navy to withdraw and control the vessel, but no rescue order. They arrived at the scene at 2:00 PM on April 16, 2014, but received no rescue order. Even at the evening meeting, only instructions for the Navy to withdraw and control the vessel were issued, but no rescue order was issued.


김석균 전 해경청장은 세월호 청문회에서 터무니없고 말장난에 가까운 답변으로 희생자 가족들의 분노를 샀다.

김석균 전 청장은 세월호 특별조사위 청문회 둘째날 증인으로 출석해 세월호 참사 당시 구조대원을 500명 정도로 부풀렸다는 비판에 대해 “그렇게 전국 각지에서 그렇게 많은 사람을 동원했다는 뜻이지 다 물에 빠졌다는 뜻은 아니다”라고 말했다.


 

세월호 참사 당일 민간 잠수부가 현장에 도착했지만 해경으로부터 구조 명령을 받지 못했다. 더욱이 해경 구조사령부 회의에서는 해군에 선박 철수 및 통제 지시만 내리고 구조 명령은 내리지 않았다. 이들은 2014년 4월 16일 오후 2시에 현장에 도착했으나 구조 명령을 받지 못했다. 저녁 회의에서도 해군에는 함정 철수 및 통제 지시만 내려졌을 뿐 구조 명령은 내려지지 않았다.




 

(Choi Sang-hwan, deputy head of the Korea Coast Guard, who was handed over to trial after allegations of collusion with Undin were revealed, so that Undin could take over the salvage of the hull before the Sewol had completely sank.

It was revealed as a result of the prosecution's investigation that it had directly mediated a Chinese company.-CBS Reporter Eun-Jeong Cho, No Cut News 2014-10-08 06:00)

 

When the former Samsung C&T and Cheil Industries 

merged in 2015, Cheil Industries' high corporate value

 was essential for Lee Jae-yong's smooth transfer of management control to Samsung Electronics. Indeed, 

Cheil Industries' corporate value significantly increased,

 driven by the approximately 4.5 trillion won in net profit

 generated by its subsidiary, Samsung BioLogics. However,

 this net profit wasn't generated through 

groundbreaking achievements like the development of 

new drugs.



(세월호가 완전히 침몰하기 전에 운딘이 선체 인양 작업을 맡

을 수 있도록 운딘과 공모했다는 

의혹이 드러나 재판에 넘겨진 최상환 해양경찰청 차장.

​검찰 조사 결과 중국 기업을 직접 중재한 것으로 

드러났다. -CBS 조은정 기자, 노컷뉴스 2014-10-08 06:00)


2015년 구(舊) 삼성물산과 제일모직 합병 당시 

이재용 회장의 원활한 경영권 승계를 위해서는

 제일모직의 높은 기업가치가 필수적이었다. 

실제로 제일모직의 기업가치는 자회사인

 삼성바이오로직스의 약 4조5000억원 

순이익에 힘입어 크게 상승했다. 그러나

 이러한 순이익은 신약개발 등 획기적인 성과를 통해 

창출된 것이 아니다.


<Samsung Biologics' allegation of accounting fraud is a case of great significance in itself. According to the Securities and Futures Commission, the size of the accounting fraud is over 4.5 trillion won. If the charges are confirmed after investigation and trial by the prosecution, it will cause great damage to investors and the stock market. However, there is another reason why Samsung Biologics (hereinafter referred to as 'Samba') pays more attention to the allegations of accounting fraud. Suspicions have been raised that there is a connection between the allegations of fraudulent accounting for Samba and the succession of Samsung Electronics Vice Chairman Lee Jae-yong's management rights. In particular, the prosecution said that the samba accountant fraud is the 'last puzzle' to complete the 'succession manipulation'. Source: SBS News Original Link:



<삼성바이오로직스의 분식회계 의혹은 그 자체로 의미가 큰 사건이다. 증권선물위원회에 따르면 분식회계 규모는 4조5000억원이 넘는다. 검찰의 수사와 재판을 거쳐 혐의가 확정될 경우 투자자와 증시에 큰 피해를 입힐 수 있다. 하지만 삼성바이오로직스(이하 '삼바')가 분식회계 의혹에 더욱 주목하는 이유는 따로 있다. 삼바 분식회계 의혹과 이재용 삼성전자 부회장의 경영권 승계가 연관돼 있다는 의혹이 제기됐다. 특히 검찰은 삼바 회계사 사기 사건이 '승계조작'을 완성하기 위한 '마지막 수수께끼'라고 밝혔다. 출처: SBS뉴스 원본링크:


 After all the twists and turns, because of me

Samsung Electronics Chairman Lee Kun-hee learned that Lee Jae-yong was behind the Lee Yun-hyeong murder case.

 

At the time, Chairman Lee Jae-yong, who owned less than 0.5% of Samsung Electronics shares, could not exercise Samsung Electronics management rights.

Lee Jae-yong, who killed Samsung Electronics Chairman Lee Kun-hee on May 10, 2014

They deceived the world by saying that Chairman Lee Kun-hee was alive.

No one was allowed to enter the special room on the 20th floor of Samsung Hospital.

At the general shareholders' meeting held on July 17, 2015, the 1-3 merger between Cheil Industries and Samsung C&T was unfair.

With the merger of Cheil Industries and Samsung C&T,

Jaeyong Lee exercised management rights at Samsung Electronics.


우여곡절 끝에 나 때문에 

이건희 삼성전자 회장이 이윤형 살인사건의 배후에 이재용이 있다는 사실을 알게 됐다.


당시 삼성전자 지분 0.5% 미만을 보유한 이재용 회장은 삼성전자 경영권을 행사할 수 없었다.

2014년 5월 10일 이건희 삼성전자 회장을 살해한 이재용. 

이건희 회장이 살아있다고 세상을 속였다. 

 삼성병원 20층 특실에는 누구도 들어갈 수 없었다.

2015년 7월 17일 열린 주주총회에서 제일모직과 삼성물산의 1-3 합병은 부당했다.

제일모직과 삼성물산의 합병으로

 이재용은 삼성전자 경영권을 행사했다.


 

<Suspicions of Samsung BioLogics' accounting fraud arose when the company posted a net profit of 1.9 trillion won in 2015 after posting losses for four consecutive years since 2011. This is because the book value of Epis was reassessed from KRW 290 billion to KRW 4.8 trillion when the subsidiary Samsung Bioepis was changed to an affiliated company, and these accounting investment profits were reflected in the books.Samsung Bioepis is a joint venture with Biogen of the United States, and at the time, Samsung BioLogics owned 91.2%. Samsung reportedly judged that it had “lost control” by changing Epis from a subsidiary to an affiliate, as it increased the possibility that Biogen of the U.S. would exercise a call option that would allow it to secure a 50% stake - 1 share.

There is an argument that this drastic change in standards is because Chairman Lee Jae-yong took over the Samsung Group through the merger of the former Samsung C&T and Cheil Industries. At the time, Cheil Industries held a 46% stake in Samsung BioLogics, and by changing the standards, Cheil Industries was able to inflate the value and obtain a merger ratio favorable to Chairman Lee Jae-yong.

<삼성바이오로직스 분식회계 의혹은 2011년부터 4년 연속 적자를 기록했다가 2015년 1조9천억원의 순이익을 기록하면서 불거졌다. 자회사인 삼성바이오에피스가 계열사로 전환되면서 에피스의 장부가치가 2,900억원에서 4조8천억원으로 재평가되고, 이러한 회계투자이익이 장부에 반영됐기 때문이다. 삼성바이오에피스는 삼성바이오에피스와 합작법인이다. 미국 바이오젠, 당시 삼성바이오로직스가 91.2% 지분을 갖고 있었다. 삼성전자는 미국 바이오젠이 지분 50%(1주)를 확보할 수 있는 콜옵션을 행사할 가능성을 높인 만큼 에피스를 자회사에서 계열사로 전환해 '통제력을 상실했다'고 판단한 것으로 알려졌다.


이러한 급격한 기준 변화는 이재용 회장이 옛 삼성물산과 제일모직의 합병을 통해 삼성그룹을 인수했기 때문이라는 주장이 있다. 당시 제일모직은 삼성바이오로직스 지분 46%를 보유하고 있었는데, 기준을 바꾸면서 제일모직은 가치를 부풀려 이재용 회장에

게 유리한 합병비율을 얻을 수 있었다.


Samsung Group Chairman Lee Jae-yong is accused of manipulating accounting fraud worth 4.5 trillion won at Samsung Bio, a subsidiary of Cheil Industries, to cover up suspicions of an illegal merger. 


Samsung Republic Zombie Prosecutors indicted Samsung BaoLogics by intentionally omitting key evidence to deceive the world.  


Samsung Republic Zombie's second trial court declared him not guilty on July 17, 2025. 




July 17, 2015 Cheil Industries-Samsung C&T 3/1 Merger General Shareholder Meeting Date Same as July 17


이재용 삼성그룹 회장이 불법합병 의혹을 덮기 위해 제일모직 자회사인 삼성바이오에 4조5000억 원 규모의 분식회계를 조작한 혐의를 받고 있다. 


삼성공화국 좀비검찰은 세상을 기만하기 위해 핵심 증거를 의도적으로 누락해 삼성바오로직스를 기소했다.  


삼성리퍼블릭 좀비의 2심 재판부는 2025년 7월 17일 무죄를 선고했다. 




2015년 7월 17일 제일모직-삼성물산 3/1 합병 주주총회일자 7월 17일과 동일


 


 

 

 

Financial authorities determined that Samsung BioLogics committed approximately 4.5 trillion won in accounting fraud in fiscal year 2015, including converting Samsung Bioepis from a subsidiary to an affiliate and unfoundedly altering the value of the company's stock. The authorities stated, "Samsung BioLogics arbitrarily interpreted accounting standards and intentionally violated them." The "Samsung Republic Zombie Court" acquitted Samsung BioLogics in its second trial on charges of 4.5 trillion won in accounting fraud.

 금융당국은 삼성바이오로직스가 2015회계연도에 삼성바이오에피스를 자회사에서 계열사로 전환하고, 부당하게 주가를 변조하는 등 약 4조5000억원 규모의 분식회계를 저질렀다고 판단했다. 당국은 “삼성바이오로직스가 회계기준을 자의적으로 해석해 고의로 위반했다”고 밝혔다. '삼성공화국 좀비법원'이 삼성바이오로직스에 4조5000억원 분식회계 혐의로 2심에서 무죄를 선고했다.

 

Lee Jae-yong sank the Sewol ferry and sacrificed 304 people to Satan. His plan was to shake up Korea, throw it into chaos, and use the opportunity to seize control of Samsung Electronics.

On April 16, 2014, the Sewol ferry disaster, in which 304 people died, sent South Korea into panic, and on May 10, 2014, Samsung Group Chairman Lee Kun-hee was assassinated. Jaeyong Lee killed his father and lied to the world that Chairman Lee Kun-hee was alive.

And on July 17, 2015

I was extremely anxious, fearing that the merger of Samsung C&T and Cheil Industries would be canceled at the shareholders' meeting.

On May 10, 2014, Samsung Group Chairman Lee Kun-hee was assassinated. Jaeyong Lee killed his father and lied to the world that Chairman Lee Kun-hee was alive. And on July 17, 2015

Demon Jae-yong Lee was extremely anxious, fearing that the approval for the merger between Cheil Industries and Samsung C&T would be canceled at the general shareholders' meeting.

이재용은 세월호를 침몰시키고 304명을 사탄에게 제물로 바쳤다. 그의 계획은 대한민국을 뒤흔들어 혼란에 빠뜨리고, 그 기회를 이용해 삼성전자를 장악하려는 것이었다.


2014년 4월 16일 304명이 사망한 세월호 참사로 대한민국은 패닉에 빠졌고, 2014년 5월 10일 이건희 삼성그룹 회장이 암살됐다. 이재용은 아버지를 죽이고 이건희 회장이 살아있다고 세상에 거짓말을 했다.


그리고 2015년 7월 17일


삼성물산과 제일모직의 합병이 주주총회에서 무산될까 봐 극도로 불안했습니다.


2014년 5월 10일 이건희 삼성그룹 회장이 암살됐다. 이재용은 아버지를 죽이고 이건희 회장이 살아있다고 세상에 거짓말을 했다. 그리고 2015년 7월 17일



악마 이재용 씨는 주주총회에서 제일모직-삼성물산 합병 승인이 취소될까 봐 극도로 불안해했다.


Middle East Respiratory Syndrome (MERS) is an infectious disease that began to spread in Korea when the first patient who traveled to the Middle East was confirmed on May 20, 2015.

MERS was intentionally spread through Samsung Hospital just before the general shareholders' meeting.

On June 2, 2015, a site called Samsung Republic Zombie The Facts released a photo of Chairman Lee Kun-hee in his hospital room, but it is impossible to confirm who he is just from the photo.

중동호흡기증후군(MERS)은 2015년 5월 20일 중동을 여행한 첫 환자가 확인되면서 국내에 퍼지기 시작한 감염병이다.


메르스는 주주총회 직전 삼성병원을 통해 고의로 전파됐다.



2015년 6월 2일 삼성공화국 좀비 더팩트라는 사이트에는 이건희 회장의 병실 사진이 공개됐으나, 사진만으로는 그가 누구인지 확인할 수 없다.





The first patient was confirmed to have Middle East respiratory syndrome coronavirus on May 20, 2015.

Samsung Seoul Hospital is being criticized for being cited as the main culprit in the spread of Middle East Respiratory Syndrome (MERS).

 

Samsung Seoul Hospital is being criticized for being passive in disclosing MERS-related information.

 

On June 8, 2015, Seoul Mayor Park Won-soon repeatedly requested Samsung Seoul Hospital to submit ERS-related data.


첫 번째 환자는 2015년 5월 20일 중동 호흡기 증후군 코로나바이러스로 확인되었습니다.


삼성서울병원이 중동호흡기증후군(MERS) 확산의 주범으로 지목돼 비판을 받고 있다.


 


삼성서울병원이 메르스 관련 정보 공개에 소극적이라는 비판을 받고 있다.


 



2015년 6월 8일 박원순 서울시장은 삼성서울병원에 ERS 관련 자료 제출을 거듭 요청했다.




Why the MERS ‘bomb’ exploded at Samsung Seoul Hospital is still an unresolved question. In the case of Pyeongtaek St. Mary's Hospital, the 'first epicenter', health authorities conducted a detailed epidemiological investigation and cited a ward without a vent and MERS RNA found on doorknobs and air conditioners as the cause of MERS transmission. However, they are unable to provide a clear explanation for Samsung Seoul Hospital, the 'second epicenter' and the largest epicenter.

At that time, I announced on the Internet that Samsung Electronics Chairman Lee Kun-hee had already been murdered.

Lee Jae-yong's trash expressed anxiety ahead of the general shareholders' meeting for the merger of Cheil Industries and Samsung C&T on July 17, 2015, fearing that approval would be rejected.


삼성서울병원에서 메르스 '폭탄'이 터진 이유는 아직도 풀리지 않는 의문이다. '1차 진원지'인 평택성모병원의 경우 보건당국이 정밀 역학조사를 실시한 결과 통풍구가 없는 병동과 문손잡이, 에어컨에서 발견된 메르스 RNA가 메르스 감염 원인으로 지목됐다. 하지만 '제2 진원지'이자 최대 진원지인 삼성서울병원에 대해서는 명확한 설명을 내놓지 못하고 있다.


당시 나는 이건희 삼성전자 회장이 이미 살해됐다고 인터넷에 알렸다.



이재용 쓰레기는 2015년 7월 17일 제일모직과 삼성물산의 합병을 위한 주주총회를 앞두고 승인이 거부될까 봐 불안감을 나타냈다.

 

Samsung Hospital took advantage of the chaos in Korea due to the MERS outbreak and released a fake photo claiming that Chairman Lee Kun-hee was alive.

Seoul Mayor Park Won-soon held an emergency press conference on the night of June 4, 2025, and criticized Samsung Hospital to media broadcast reporters, saying at the press conference, “The doctor at Seoul Samsung Hospital (patient 35), who was confirmed to have MERS, had direct or indirect contact with about 1,500 citizens.”

삼성병원은 메르스 사태로 인한 국내 혼란을 틈타 이건희 회장이 살아있다고 주장하는 가짜 사진을 공개했다.



박원순 서울시장은 2025년 6월 4일 밤 긴급기자회견을 열고 언론방송 취재진을 향해 삼성병원을 향해 “메르스 확진 판정을 받은 서울삼성병원 의사(35번 환자)가 시민 1500여 명과 직·간접적으로 접촉했다”고 비난했다.





On June 4, 2015, former Seoul Mayor Park Won-soon held an emergency press conference and announced, "Patient #35, a doctor at a hospital in Seoul (Samsung Seoul Hospital) who tested positive for MERS, had direct or indirect contact with approximately 1,500 citizens."

 

On June 5, the day after the press conference, the Medical Innovation Struggle Committee filed a complaint with the Supreme Prosecutors' Office, accusing Seoul Mayor Park of defaming the doctor at Samsung Seoul Hospital without properly verifying the facts.

 

Seoul Mayor Park Won-soon, who challenged the Republic of Samsung, was murdered on July 9, 2020, and the Samsung Republic zombie police concluded his death was a suicide without an autopsy.

박원순 전 서울시장은 2015년 6월 4일 긴급기자회견을 열어 “서울 소재 한 병원(삼성서울병원) 의사 35번 환자가 메르스 양성 판정을 받아 시민 1500여 명과 직·간접적으로 접촉했다”고 밝혔다.


 


의료혁신투쟁위원회는 기자회견 다음 날인 6월 5일 박 시장이 사실관계를 제대로 확인하지 않은 채 삼성서울병원 의사의 명예를 훼손했다는 혐의로 대검찰청에 고발장을 제출했다.


 


삼성공화국에 도전했던 박원순 서울시장이 2020년 7월 9일 살해됐고, 삼성공화국 좀비 경찰은 그의 죽음을 부검 없이 자살로 결론 내렸다.


 

1. Go to NBC articlehttp://nbcnews.to/1sgce2T

South Korea Ferry Crew: We Were Ordered to Abandon Sinking Ship

A crew member on the sunken South Korean ferry said on Thursday she and her colleagues were “under command” to abandon ship while passengers were trapped on board.

The unidentified crew member spoke briefly to reporters on the way from court back into detention. She was wearing a surgical mask and a baseball cap with a jacket hood.

Investigations are focused on human error and mechanical failure, but authorities have expressed anger at the actions of the crew, most of whom survived after abandoning the Sewol while passengers were still on board.

Sunken ship left port with 3 times maximum cargo load

Hundred of passengers died after being told to stay in place rather than escaping the ship.

South Korea’s president Park Geun-hye on Monday accused the captain and crew of the country’s sunken ferry of “unforgivable, murderous behavior.”

More than 300 people, most of them students and teachers from the same school, are dead or missing presumed dead in the April 16 disaster. As the ferry began sinking, the crew told the children to stay in their cabins.

- Reuters

http://nbcnews.to/1sgce2T)


1. NBC 기사 바로가기 ☞http://nbcnews.to/1sgce2T


한국 여객선 선원들: 우리는 침몰하는 배를 버리라는 명령을 받았습니다


침몰한 한국 여객선의 한 승무원은 목요일 승객들이 배에 갇혀 있는 동안 그녀와 그녀의 동료들이 배를 버리라는 "명령을 받았다"고 말했습니다.


신원이 밝혀지지 않은 승무원은 법원에서 구금 장소로 돌아가는 길에 기자들과 간략하게 이야기했습니다. 그녀는 수술용 마스크와 재킷 후드가 달린 야구 모자를 쓰고 있었습니다.


조사는 인적 오류와 기계적 결함에 초점을 맞추고 있지만, 당국은 승객들이 탑승한 상태에서 대부분 세월호를 버리고 살아남은 승무원들의 행동에 분노를 표명했습니다.


침몰한 선박은 최대 화물 적재량의 3배를 싣고 항구를 떠났습니다.


배에서 탈출하지 말고 제자리에 있으라는 지시를 받은 승객 수백 명이 사망했다.


박근혜 대통령은 월요일 침몰한 여객선의 선장과 선원들을 “용서할 수 없는 살인적인 행위”라고 비난했다.


4·16 참사로 대부분 같은 학교 학생과 교사 등 300여 명이 사망하거나 실종된 것으로 추정된다. 페리가 가라앉기 시작하자 승무원들은 아이들에게 선실에 머물라고 말했습니다.


- 로이터


http://nbcnews.to/1sgce2T)

 

<Samsung Electronics, Satan's vicious henchman, must be published in a book and made known to the world, and Samsung Electronics must be brought down.

 

(Samsung Group Chairman Lee Yun-hyung's third daughter dies in car accident, mystery MBC News [Reporter Kim Se-yong]

Entered 2005-11-22 |

[Lee Kun-hee’s youngest daughter dies… question]

Anchor: Samsung Electronics Chairman Lee Kun-hee’s third daughter, Yoon Hyeong

He passed away in New York, USA.

Samsung Electronics stated that it was a car accident, but there are many questions, including the hospital where the patient was admitted.

This is reporter Kim Se-yong from New York.

Reporter: According to Samsung Group, Yunhyeong was involved in a car accident in New York on November 18, 2005 and was taken to the hospital, but died on the 19th.

The funeral was held yesterday, November 21, 2005.

Chairman Lee Kun-hee, who has been staying in another part of the United States for over two months, did not attend, and instead Hong Ra-hee, Lee Jae-yong, Lee Boo-jin, and Lee Seo-hyun attended. -.

After the funeral, it was confirmed that Lee Boo-jin and Lee Seo-hyeon returned to Korea on a night flight.

Everything was done in secret.

 

<사탄의 악랄한 심복 삼성전자는 책으로 출판되어 세상에 알려져야 하고, 삼성전자는 무너져야 합니다.


 


(이윤형 삼성그룹 회장 셋째 딸 교통사고로 사망, 미스터리 MBC뉴스 [김세용 기자]


2005-11-22 입사 |


[이건희 막내딸 사망…질문]


●앵커: 이건희 삼성전자 회장 셋째 딸 윤형 씨


미국 뉴욕에서 세상을 떠났습니다.


삼성전자는 교통사고였다고 밝혔으나, 환자가 입원한 병원을 비롯해 의문점이 많다.


뉴욕 김세용 기자입니다.


기자: 삼성그룹에 따르면 윤형은 2005년 11월 18일 뉴욕에서 교통사고를 당해 병원으로 옮겨졌으나 19일 사망했습니다.


장례식은 2005년 11월 21일 어제 거행되었습니다.


미국 타 지역에 두 달 넘게 머물고 있는 이건희 회장은 참석하지 않았고, 대신 홍라희, 이재용, 이부진, 이서현 등이 참석했다. -.


장례식 후 이부진과 이서현은 야간 비행기를 타고 귀국한 것으로 확인됐다.


모든 일은 비밀리에 이루어졌습니다.


Of New York's 20 hospitals with emergency rooms, 16 said they had never had a young Asian woman transported from a car accident, while the remaining four hospitals said they could not confirm.

Hospital staff: Even if it has been a long time, if you have been admitted to a hospital, records remain. There is no such record.

 

As Samsung Electronics' official announcement is being delayed, speculation is emerging about the cause of death.

This is Se-yong Kim from MBC News in New York.>


뉴욕의 응급실이 있는 20개 병원 중 16개 병원은 젊은 아시아 여성을 교통사고로 후송한 적이 없다고 밝혔고, 나머지 4개 병원은 확인할 수 없다고 밝혔다.


●병원직원 : 오랜 시간이 지나도 병원에 입원했다면 기록은 남습니다. 그런 기록은 없습니다.


 


삼성전자의 공식 발표가 늦어지면서 사망 원인에 대한 추측이 나오고 있다.


뉴욕 MBC뉴스 김세용입니다.>




<Sunday Journal usa .Vol. 943 posted on August 24, 2014 by secureadmin in>A funeral in top secret after cremation after 3 days of committing suicide for some reasonIt is impossible to tie the neck with a power cord while your feet are on the floor.

 

Why did Samsung announce that Chairman Lee Kun-hee's youngest daughter, Lee Yoon-hyung, died in a car accident, and then change it to suicide? Rumors are circulating that Chairman Lee Kun-hee's youngest daughter, Lee Yoon-hyung, was treated coldly by her family.

Chairman Lee Kun-hee, who was admitted to Samsung Hospital on May 10, 2014, has not yet woken up from a coma, but Samsung Group has already begun the process of distributing the inheritance to the three siblings, Lee Jae-yong, Lee Boo-jin, and Lee Seo-hyun.

 

However, in relation to this,

On November 19, 2005,

Samsung Group Chairman Lee Kun-hee's youngest daughter Lee Yoon-hyung's death

Suspicions have been raised that it was not suicide but murder.

On November 22, 2005, Samsung announced that Chairman Lee Kun-hee's youngest daughter Lee Yoon-hyung died in a car accident on November 18, 2005, outside of New York, USA.

Lee Yoon-hyung's remains were secretly cremated on the 21st, the day before the announcement, with outsiders prohibited from entering.

 

However, when the New York Hankook Ilbo and the New York Times raised questions about the whereabouts of Mr. Lee Yoon-hyung's body and reported that there had been no traffic accident deaths in New York at the time, Samsung changed its statement four days later on November 26 to state that Mr. Lee had not died in the traffic accident but had taken his own life, further raising suspicions.

 

The question is, 'Why did Samsung announce that it was a traffic accident when they knew that Lee Yoon-hyung committed suicide?'

 

 

"Why did he cremate her after only 3 days?" Despite these suspicions at the time, the death of Lee Yoon-hyung was forgotten by the world, and

Recently, as the claim that Lee Yoon-hyung committed suicide but was murdered has been raised, the case is spreading uncontrollably.

We have comprehensively summarized the content of the murder theory of Lee Yoon-hyung currently posted on the bulletin boards and blogs of various media outlets including this newspaper. Recently, articles about the death of Samsung's youngest daughter Lee Yoon-hyung, who died on November 19, 2005, have been posted on social media.

 

The shocking claims about Lee Yoon-hyung's death that appear on portal sites such as Daum and Naver and some media blogs are beyond imagination.

 

According to this content, Lee Yoon-hyung, the youngest daughter of Chairman Lee Kun-hee, has a different mother than Chairman Lee Jae-yong's three siblings, and Lee Yoon-hyung was murdered by a family member due to the complicated family history of the Samsung conglomerate. At the same time, he introduced himself as someone who worked with him for ten days at a Japanese restaurant called 'Asuka' in North Carolina three years before his death.

Why did Samsung first announce a traffic accident and then change it to suicide? A reporter for the New York Hankook Ilbo, after a relentless investigation and tracking, tracked him down. However, they were unable to locate a report filed by the New York police regarding Mr. Lee Yoon-hyung's traffic accident, nor was they able to locate the hospital he was transferred to after the accident.

 

Reporters who thought that Samsung's announcement that Mr. Lee Yoon-hyung died in a traffic accident was not true eventually heard that Mr. Lee's body was found in his luxury condo apartment, claiming that he had taken his own life

(in fact, this was also fabricated. Mr. Lee Yoon-hyung was meticulously murdered).

 

When Shin Yong-il, a reporter for the New York Hankook Ilbo, heard that Lee Yoon-hyung's boyfriend, Shin Soo-bin, and his friend, two people, were found hanging from the doorknob of his apartment,

Samsung strongly blocked the article.

However, the article was forwarded to the New York Times, and when the New York Times article came out on November 26, 2005,

Samsung Group quickly changed the report to report it as suicide, not a traffic accident.

 


After Samsung Reports Accident, Painful Details of Suicide EmergeBy

ByAl Baker

Nov. 26, 2005

The news from the Samsung Group seemed to be a straightforward jolt of sadness for the head of the powerful South Korean company that has been enveloped in controversy this year.

Lee Yoon-hyung, 26, the youngest daughter of the company's chairman and one of the richest men in South Korea, had died in a car crash somewhere in the New York City area last weekend.

Korean newspapers, in both New York and Seoul, reported it that way. New York University, where the woman was a graduate student, received the same account from reporters and from Samsung's public relations representative in New York.

In the English-language edition of The Korea Herald, a Samsung official was quoted as saying that the company would not provide many details and also sought "to avoid unnecessary rumors that may circulate" about the daughter of its high-profile chairman, Lee Kun-hee.

The New York police had no record of a fatal motor vehicle accident involving Ms. Lee. No one could say exactly where the accident happened or when. An editor at a local Korean newspaper, The Korea Times, mobilized three reporters to investigate.

 

Around 3 a.m. last Saturday, her boyfriend, Shin Soo-bin, and his friend found her hanging from a wire plugged into the door of their Manhattan apartment.

 

A Samsung Group spokesperson initially believed the death was caused by a traffic accident, and stated this in response to reporters' questions.

 

Mr. Lee Yoon-hyung's funeral was held in New York City on the morning of November 22, 2005.

The funeral was held in a Won-Buddhist ceremony in the early morning hours, and his remains were cremated prior to the Won-Buddhist funeral held in the United States.

His remains were then repatriated to Korea and laid to rest in a cemetery near Samsung Everland.



The cremation funeral process can be broadly divided into cremation reservation

and reception, cremation, ashes collection, and ashes placement (coffin, scattering, etc.).

First, a cremation reservation is made, and cremation is performed at a cremation facility.

After cremation, the ashes are collected, placed in an urn, and delivered to the bereaved

family. Afterwards, the bereaved family can place the ashes in a columbarium or

columbarium, or scatter the ashes.



Lee Yoon-hyung died on November 19, 2005, but outside mourning was prohibited

and the funeral was held secretly on November 22, three days later.

They say she was cremated before the funeral, so did she cremate her body two days later?

It is certain that no autopsy was performed.

 

<An autopsy to accurately determine the cause of death typically takes at least two to three weeks, or even several months, to release autopsy results, depending on the condition of the body, the type of autopsy, and the processing speed of the relevant authorities.>

The New York medical examiner's report only found visible signs of pressure around

the neck,

but did not provide clear evidence to prove suicide.

Of course.

It is said that it takes at least 2-3 weeks to determine the cause of death through

an autopsy.

Lee Yoon-hyung's body was cremated two days later.

Therefore, it is certain that an autopsy was not performed.

It is impossible for a medical examiner to immediately determine the cause of

death through a visual examination alone.

However, all domestic newspapers and broadcasting companies, including the New

York Times, distorted the truth and reported that Lee Yoon-hyung's suicide was

confirmed.

"He who controls the past controls the future. He who controls the present controls the

past." Like George Orwell's novel "1984," Lee Yoon-hyung's body was fabricated as a

suicide without an autopsy.

Samsung Group members Hong Ra-hee, Hong Seok-hyun, Lee Jae-yong, Lee Boo-jin, and Lee Seo-hyun cremated Lee Yoon-hyung's body in a Won-Buddhist manner within two days, completely prohibited outside visitors, and quickly concealed the evidence of the murder.

After the funeral on November 22, they quickly concealed the evidence of the murder, falsely stating to reporters that Lee Yoon-hyung died in a traffic accident. This fact was reported by domestic broadcasters such as KBS, MBC, and SBS, clearly showing that evidence cannot be concealed forever.

 

The photo below is of Won Buddhism in North Carolina, a religion believed in by Hong Ra-hee, the mother of Samsung Electronics Chairman Lee Jae-yong.


 





 

 

<8021 Old NC 86, Chapel Hill, NC 27516 United States

Won Buddhism North CarolinaChurch Address - Reference - Samsung Group Religion Won Buddhism>

Samsung Electronics Chairman Lee Jae-yong's mother, Hong Ra-hee, is a devout Won-Buddhist believer.Won Buddhism in North Carolina, USA.

<8021 Old NC 86, Chapel Hill, NC 27516 United States>

 


Won Buddhism in North Carolina

 

This is located in the Triangle Study Area of ​​North Carolina, known as the final battleground during the American Civil War.

 

(Korean: Triangle Study Committee) Vice President of Asia Branch Hong Seok-hyun and Chairman Lee Jae-yong of Samsung Electronics

 

Hong Seok-hyun's maternal nephew Lee Jae-yong

 

 

'At the time, Chairman Lee Kun-hee was receiving cancer treatment in Texas, USA, and was fleeing to the United States to avoid the Roh Moo-hyun government's Samsung X-file investigation.

 

The time and date of Mr. Lee Yoon-hyung's death is a scenario planned in advance by Samsung Electronics' Lee Jae-yong, in accordance with Satanic Illuminati numerology.

 

half-youngest sister Lee Yun-hyeong, who was murdered by Samsung Electronics Chairman Lee Jae-yong Date of death November 19, 2005 =2+5+1+1+1+9=19= Why "Number 19"? covid-19? Why "Number 19"?

19: It has magical meaning. It is also a number symbolizing the Second Coming.

The number 19 is also a number used to cause events/accidents or make blood sacrifices based on the natural phenomenon of the sun and moon having the same cycle every 19 years.

Therefore, Satan's servants symbolize the number 19, signifying the ongoing human and blood sacrifices for Satan.

At the same time, they called themselves the high priests of Satan.

So Satan's servants use it as a kind of performance to remind themselves that Satan is their master.

 

 

 

 

And when the New York Times reported that they were trying to manipulate the cause of death of Mr. Lee Yoon-hyung in a traffic accident, Samsung lied again, saying that the cause of death of Mr. Lee Yoon-hyung was suicide. Samsung Electronics devil Lee Jae-yong.

The author claims that Mr. Lee Yoon-hyung worked with him at a Japanese restaurant in North Carolina, USA, three years before his death.

 

When the newspapers reported that Lee Yoon-hyung had been cremated in a hurry, had a secret emergency funeral, and even lied to reporters about dying in a car accident, it became clear that Samsung Group could never hide this ugly fabrication.

 

In order to find the clues of the case only by observation and combine the clues scattered around the place to find out the course of the case, narrow down the investigation net by checking the circumstances of the case or surrounding circumstances, and substituting the information collected in it with the observed facts one by one.

As we move forward, the culprit is revealed. Historical claims are important, but to draw conclusions in advance and reach them is like a criminal committing a crime according to a pre-planned scenario.

The suspicious body of Lee Yoon-hyung, the youngest daughter of South Korea's richest man, Lee Kun-hee, was reportedly discovered by two people: Shin Soo-bin and another culprit.

 

In cases where there are no witnesses to a death, a thorough autopsy is essential to uncover evidence of murder. However, Samsung Electronics Vice Chairman Lee Jae-yong refused an autopsy, cremated the body two days later to conceal evidence of murder, prohibited outside mourners from attending the funeral, and

Samsung Group officials lied to the press and broadcasters, claiming Lee Yoon-hyung's death was a traffic accident.

 

In 2002, Lee Yoon-hyung and Shin Soo-bin were spotted at the Asuka Japanese Restaurant in North Carolina. At the time, Shin Soo-bin looked like a bodyguard. Now, if we dig deeper, it is highly likely that he was a murderer disguised as a bodyguard hired by Lee Jae-yong.

 

The person most aware of Lee Yoon-hyung's death is likely Samsung Electronics Vice Chairman Lee Jae-yong. His body was hastily cremated two days later, seemingly in an attempt to conceal evidence of the murder.

 

 

That is the time when Chairman Lee Kun-hee was treated for cancer in Texas and was uncomfortable with his movements and he was confused by the Samsung X-file investigation. It was compact. Samsung's story of Samsung from former JoongAng Ilbo reporter Lee Yong-woo | Gamgodang | July 12, 2013 What is the

 

“Samsung () book launched by the JoongAng Ilbo? Samsung Chairman Lee Kun-hee told the JoongAng Ilbo reporter that Samsung Chairman Lee Kun-hee gave birth to Lee Yoon-hyung and had a vasectomy in the former Samsung book.

 

The Times, a major British daily newspaper, reported in a report on November 29, 2005 that Korean newspapers allegedly reported that the youngest daughter of Samsung Chairman Yoon-hyung Lee died in a car accident, at the word of the US New York police and medical staff supported by Samsung. However, an exploration article such as Shin Yong-il, a reporter from the Hankook Ilbo in New York, reported to the New York Times that he admitted to suicide late after the local time report in New York on November 26.

 

The Times reported that Chairman Lee Kun-hee, who is known to be receiving cancer treatment in the United States on the premise that

 

“Samsung also has a dark side, is dropping contact by refusing to summon the National Assembly. Along with this, it was reported that Samsung’s power and influence in Korea is growing and it is being criticized as the Samsung Republic. Various suspicions were raised in the process of being reported as “the first was reported to have died in a fatal traffic accident, and then a Buddhist funeral was held.”

 

When an article reported that the New York Times was not dead in a car accident on November 26, 2005, Samsung again revealed that she ‘has committed suicide,’ shocking the world once again. Samsung's response to the death of Yoon-hyung Lee, which is heard that it has more intelligence than the Korean government, was a clumsy response that was not like an international conglomerate.

 

This is an insult to the people and society, and an act that insults the dignity of a human being named Lee Yoon-hyung. "The dead do not speak." However, traces of death still remain. When the news of Yoon-hyung's death was first reported on November 21, 2005 through Chosun.com and other media outlets, Yoon-hyung died in a traffic accident on November 18, 2005, and was diagnosed dead in the early morning of November 19, 2005.

 

Samsung said she was cremated according to Won Buddhism funeral procedures. As news of Yoon Hyung’s traffic accident was quickly reported by major media outlets at home and abroad, a wave of sorrowful condolences followed from those who heard the news of Yoon Hyung’s young death in a foreign country.

 

This was also followed However, after relentless pursuit of local media over the cause of death, it was revealed that it was not a traffic accident, and Samsung’s lies are alarming. Samsung lied that Yun-hyung Lee was transferred to a hospital in New York in an accident while driving outside New York on the 18th while studying at New York University, USA, but died the next morning. Samsung also announced that Yun-hyung Lee's funeral was held in New York on the morning of the 21st in a secret manner and banned external condolences and was held in a simple Won-Buddhist style.

 

Pressed by the huge power of the Samsung Group This is because it was difficult to make an effort to find physical evidence. However, reporter Shin Yong-il and the reporting team persistently tracked this, and on the 23rd, Lee Yun-hyung had already secured physical evidence that Yun-hyung Lee was not killed in a traffic accident. Samsung's announcement said that it was not a traffic accident because there were no circumstances that could be considered as being killed in a traffic accident, such as the time and location of the victim or the perpetrator, no vehicle and no witnesses.

 

When Samsung announced that he died in a car accident, there was news that the body of Lee Yun-hyung was burned and cremated to have a funeral, but he added that he felt that it was driven by a written script < Sunday Journal Reporter Kim Hyun-il>

 

 

The Sunday Journal reported that Lee Yoon-hyung's funeral was held on November 21, 2005, but other sources say it was held on the 22nd. What is certain is that Samsung announced to reporters after the funeral on the 22nd that Lee Yoon-hyung had died in a car accident on the 19th. Therefore, it is highly likely that Lee Yoon-hyung's body was cremated two days later.

It is puzzling why the cremation and funeral were rushed, given the intent to conceal evidence of Lee Yoon-hyung's murder.

 

Samsung Lee Yoon-hyung's Funeral Date

November 22, 2005 = 2+5+1+1+2+2=13= In Illuminati numerology, 13 is an important number symbolizing Satan, the dragon, and the snake.

 

I believe that Samsung Electronics Chairman Lee Jae-yong, who is the devil, used all his power and money to cover up the truth of the incident and manipulated and covered up Lee Yoon-hyung's immigration records and information.

The coroner's report found only visible pressure marks around the neck, but no clear evidence of suicide.

This was because a proper autopsy was not performed.

Since there was no clear evidence that Lee Yoon-hyung committed suicide,

 

Lee Yoon-hyung's body was hastily cremated at a Won Buddhist funeral, a cunning attempt to conceal evidence of murder.

 

The photo below shows Lee Bu-jin and Lee Seo-hyun returning to Korea on November 23, 2005, after attending Lee Yoon-hyung's funeral.






<The autopsy required to accurately determine 

the cause of death takes several

days depending on the condition of the body, the type of autopsy, and the

processing speed of the relevant agency. Generally, it can take at least

2-3 weeks to several months to issue the autopsy report.>

 

Samsung Group members Hong Ra-hee, 

Hong Seok-hyun, Lee Jae-yong, Lee Boo-jin, 

and Lee Seo-hyun cremated Lee Yoon-hyung's 

body in a Won-Buddhist ceremony 

within two days, completely barred outside

 visitors, and swiftly concealed evidence of the murder.

 

After the funeral on November 22nd, they falsely

 claimed to reporters that Lee Yoon-hyung had

 died in a car accident, swiftly concealing the

 evidence. This fact was reported by domestic broadcasters such as KBS, MBC, and SBS, demonstrating that evidence cannot be concealed forever.


<사망 원인을 정확하게 규명하기 위해 필요한 부검에는 여러 시간이 소요됩니다.

신체상태, 부검의 종류,

해당 기관의 처리 속도. 일반적으로 최소한

부검 보고서 발급까지 2~3주에서 수개월 소요.>


삼성그룹 멤버 홍라희, 홍석현, 이재용, 이부진, 이서현은 

원불식으로 이윤형의 시신을 이틀 만에 

화장해 외부 방문객을 전면 금지하고, 살인 증거를 신속히 

은폐했다.


이들은 지난 11월 22일 장례식 이후 기자들에게 이윤형이

 교통사고로 사망했다고 허위 주장하며 신속하게 증거를 

은폐했다. 이 사실은 KBS, MBC, SBS 등 국내 방송사를

 통해 보도되며 증거가 영원히 은폐될 수 없음을 입증했다.



 


Each fraction represented in the Eye of Horus corresponds to 1/64, 1/32, 1/16, 1/8, 1/4, and 1/2. A closer look reveals that each fraction decreases by a factor of 1/2. If you were to draw the image as is, you would see a curiously clockwise curve. The 1/64th fraction represents the human sense of touch.

호루스의 눈에 표현된 각 분수는 1/64, 1/32, 1/16, 1/8, 1/4, 그리고 1/2에 해당합니다. 자세히 살펴보면 각 분수가 1/2씩 감소하는 것을 알 수 있습니다. 그림을 있는 그대로 그리면 시계 방향으로 이상한 곡선이 나타납니다. 1/64 분수는 인간의 촉각을 나타냅니다.


1/32 represents taste, 1/16 represents hearing. Furthermore, 1/8 represents thought, 1/4 represents sight, and 1/2 represents smell.
Also, let's unify the denominators of the fractions represented in the Eye of Horus to 64. While the denominators remain constant at 64—1/64, 2/64, 4/64, 8/64, 16/64, and 32/64—
the sum of the numerators is 1+2+4+8+16+32=63.





1/32는 미각, 1/16은 청각을 나타냅니다. 또한 1/8은 사고, 1/4은 시각, 1/2은 후각을 나타냅니다.
또한, 호루스의 눈에 나타난 분수의 분모를 64로 통일해 봅시다. 분모는 64로 일정하게 유지되지만(1/64, 2/64, 4/64, 8/64, 16/64, 32/64), 

분자의 합은 1+2+4+8+16+32=63입니다.



The presidential election was held on June 3rd, and Lee Jae-myung, a zombie parasite of Samsung and the Chinese Communist Party, was elected through fraud. (Including all Samsung Group affiliates controlled by the devil's cockroach, Lee Jae-yong, the total number of companies is 63.)


In the multiplication table, 6 x 3 = 18 = 666. 666 is the beast in the Book of Revelation.



6월 3일 대선이 치러졌고, 삼성과 중국 공산당의 좀비 기생충인 이재명이 부정선거를 통해

 당선되었습니다.

 (악마의 바퀴벌레 이재용이 지배하는 삼성그룹 계열사를 모두 포함하면 총 63개 기업입니다.)


구구단에서 6 x 3 = 18 = 666입니다. 666은 요한계시록에 나오는 짐승입니다.





What's truly shocking is that the Constitutional Court, the Republic of Samsung, and the Chinese Communist Party's zombie-like Constitutional Court judges postponed Yoon Seok-yeol's impeachment trial for a single reason: to coincide with the June 3rd presidential election.


The Constitution stipulates that a presidential election must be held within 60 days of impeachment.


The impeachment was declared on April 4th,

and the presidential election was held 60 days later, on June 3rd.


정말 충격적인 것은 헌법재판소, 삼성공화국, 그리고 좀비 같은 중국 공산당 헌법재판소 판사들이 윤석열 탄핵 재판을 단 하나의 이유로 연기했다는 것입니다. 바로 6월 3일 대선과 맞물리게 하기 위해서였습니다.


헌법은 탄핵 소추 후 60일 이내에 대통령 선거를 치러야 한다고 규정하고 있습니다.


탄핵은 4월 4일에 선포되었고,

대선은 60일 후인 6월 3일에 치러졌습니다.





?


In fact, it is a symbolic event that Lee Jae-yong and Hong Seok-hyun, the devils of the Republic of Samsung who control the Central Election Management Committee, the National Assembly, the judiciary, and the executive branch of the Republic of Korea, chose Lee Jae-myung. Hong Seok-hyun met Lee Jae-myung and Lee Jae-yong on March 20 (there is a story that the person who actually arranged this meeting was Lee Jae-yong's maternal uncle Hong Seok-hyun). After this meeting, conservative panelists (propagandists of the shadow regime), including Jeong Gyu-je and Jo Gap-je, began to praise Lee Jae-myung all at once, and then on March 26, he was found not guilty in the second trial for violating the election law. I think the timing is too exquisite to be dismissed as a simple coincidence.


사실 대한민국 중앙선거관리위원회, 국회, 사법부, 행정부를 쥐고 있는 삼성공화국의 악마들, 이재용과 홍석현이 이재명을 택한 것은 상징적인 사건입니다.홍석현은 3월 20일 이재명과 이재용을 만났습니다(실제로 이 만남을 주선한 사람이 이재용의 외삼촌 홍석현이었다는 이야기가 있습니다).이 만남 이후 정규제, 조갑제 등 보수 패널(그림자 정권의 선전원)들이 일제히 이재명을 칭찬하기 시작했고, 그러다 3월 26일 선거법 위반 혐의로 2심에서 무죄 판결을 받았습니다.단순한 우연으로 치부하기에는 타이밍이 너무 절묘하다고 생각합니다.




3:05
지금 재생 중
나중에 볼 동영상
현재 재생목록에 추가










The Eye of Horus holds a mathematical secret. It consists of six parts, each represented by a hieroglyphic symbol for a fraction with a numerator of 1, a symbol commonly used by the Babylonians and Egyptians of the time.

호루스의 눈은 수학적 비밀을 품고 있습니다. 여섯 부분으로 구성되어 있으며, 각 부분은 분자가 1인 분수를 나타내는 상형 문자로 표현되었는데, 이는 당시 바빌로니아인과 이집트인들이 흔히 사용했던 기호입니다.
The article argues that the Riemann Hypothesis, the pyramid of prime numbers, and the fractions associated with the Eye of Horus in quantum mechanics are deeply connected to human senses, particularly the law of diminishing returns. This law of diminishing returns is exemplified by the fact that when touch, taste, hearing, thinking, sight, and smell are represented as fractions of 1/64, 1/32, 1/16, 1/8, 1/4, and 1/2, respectively, the sum of these fractions is 63/64. Furthermore, it argues that this phenomenon is related to understanding animal mating behavior as a genetically programmed instinctive behavior.

이 논문은 리만 가설, 소수 피라미드, 그리고 양자역학에서 호루스의 눈과 관련된 분수가 인간의 감각, 특히 수확 체감의 법칙과 깊이 연관되어 있다고 주장합니다. 이 수확 체감의 법칙은 촉각, 미각, 청각, 사고, 시각, 후각을 각각 1/64, 1/32, 1/16, 1/8, 1/4, 1/2의 분수로 나타낼 때, 이 분수들의 합이 63/64라는 사실에서 잘 드러납니다. 더 나아가, 이 현상은 동물의 짝짓기 행동을 유전적으로 프로그램된 본능적 행동으로 이해하는 것과 관련이 있다고 주장합니다.














God's eyes are not the one-eyed Egyptian all-seeing eye, but the seven spirits, the seven eyes, that move throughout the earth. In other words, they are the Seven Eyes.
하나님의 눈은 이집트인들이 만물을 보는 외눈박이 눈이 아니라, 온 땅을 돌아다니는 일곱 영, 일곱 눈입니다. 다시 말해, 일곱 눈입니다.



The given fractional sequence 1/64, 1/32, 1/16, 1/8, 1/4, 1/2 is a geometric sequence in which each term is twice the previous one. The sixth fraction in this sequence is 1/2. The number 666 in Revelation 13 is interpreted as the number of the beast, and the expression 1/2 is mentioned as one of several interpretations of this number.

주어진 분수열 1/64, 1/32, 1/16, 1/8, 1/4, 1/2는 각 항이 이전 항의 두 배인 기하수열입니다. 이 수열의 여섯 번째 분수는 1/2입니다. 요한계시록 13장의 숫자 666은 짐승의 숫자로 해석되며, 1/2라는 표현은 이 숫자에 대한 여러 해석 중 하나로 언급됩니다.


Snakes are sexually attracted to snakes, not humans.

When we scientifically uncovered the circuit that causes sea cucumbers to shrink when touched, the circuit that causes rats to respond to rewards, and the circuit that causes owls to focus sounds on specific points in the dark, we discovered that all of these are zombie systems, like the mating instincts of animals.

뱀은 사람이 아니라 뱀에게 성적으로 끌립니다.

해삼을 만졌을 때 몸이 작아지는 회로, 쥐가 보상에 반응하는 회로, 올빼미가 어둠 속 특정 지점에 소리를 집중시키는 회로를 과학적으로 밝혀냈을 때, 우리는 이 모든 것이 동물의 짝짓기 본능처럼 좀비 시스템이라는 것을 발견했습니다.


It means a blueprint of a circuit that outputs an appropriate result based on
 specific input information. If the human brain is composed only of such circuit patterns, why do we feel alive and conscious? Why don't we feel like we've
 become a zombie, nothing more?

특정 입력 정보에 따라 적절한 결과를 출력하는 회로의 청사진을 의미합니다. 인간의 뇌가 그런 회로 패턴으로만 구성되어 있다면, 왜 우리는 살아있고 의식이 있다고 느끼는 걸까요? 왜 우리는 마치 좀비가 된 것 같은 느낌, 그 이상도 이하도 아닌 것 같은 느낌을 받지 못하는 걸까요?


The ways in which Heidegger reveals the meaning of his way of being are feelings such as anxiety and boredom. These emotions are not simply emotions, but are interpreted as a conscious state that resists the instincts and unconsciousness that dominate the way of being.


하이데거가 자신의 존재 방식의 의미를 드러내는 방식은 불안, 지루함 등의 감정이다. 이러한 감정은 단순한 감정이 아니라, 존재 방식을 지배하는 본능과 무의식에 저항하는 의식적 상태로 해석된다.


For Heidegger, emotions like pure love, anxiety, and boredom go beyond mere psychological states and become crucial modes of being that reveal the meaning of Dasein, or human existence. While these emotions may appear negative on the surface, they serve as catalysts for Dasein to move beyond its unconscious and instinctive state of being and the world, and toward a more essential mode of being.

하이데거에게 순수한 사랑, 불안, 권태와 같은 감정은 단순한 심리적 상태를 넘어 현존재, 즉 인간 존재의 의미를 드러내는 중요한 존재 양태가 됩니다. 이러한 감정은 표면적으로는 부정적으로 보일 수 있지만, 현존재가 무의식적이고 본능적인 존재 상태와 세계를 넘어 더욱 본질적인 존재 양태로 나아가도록 하는 촉매 역할을 합니다.






It's reasonable to understand animal mating behavior as a genetically programmed instinctual behavior. Mating behavior, which appears to be a simple emotion or unconscious reaction, is closer to an automatic response to fulfill basic needs for survival and reproduction. It can be viewed as operating like a computer program, following rules under specific conditions.


동물의 짝짓기 행동을 유전적으로 프로그래밍된 본능적 행동으로 이해하는 것은 타당합니다. 단순한 감정이나 무의식적 반응처럼 보이는 짝짓기 행동은 생존과 번식을 위한 기본적인 욕구를 충족하기 위한 자동적인 반응에 더 가깝습니다. 특정 조건 하에서 규칙을 따르는 컴퓨터 프로그램처럼 작동하는 것으로 볼 수 있습니다.





Instinct and the unconscious are two major factors that have a great influence

 on human behavior. They can cause us to repeatedly commit certain actions 

due to unconscious impulses or desires. For example, a thief may derive unconscious

 satisfaction from stealing, or a cheater may feel an unconscious sense of superiority 

through fraud. In the case of rapists, the combination of sexual and aggressive

 impulses can lead to unconscious behavior.


본능과 무의식은 인간의 행동에 큰 영향을 미치는 두 가지 주요 요소입니다. 무의식적인 

충동이나 욕망으로 인해 특정 행동을 반복적으로 저지르게 될 수 있습니다. 예를 들어,

 도둑은 도둑질을 통해 무의식적인 만족을 얻을 수도 있고, 사기꾼은 사기를 통해 무의식적인

 우월감을 느낄 수도 있습니다. 강간범의 경우 성적 충동과 공격적 충동이 결합되어 

무의식적인 행동을 유발할 수 있습니다.


In the chaos created by Satan, the pastor preaches to restore God's order. 


Unfortunately, selling one's parents for Satan's power and money suggests that 

material desires can overpower basic human morality. This shows that the desire 

for material things can be powerful at an unconscious level.


Just like the 95% dark matter that dominates the universe, the 95% instinct and

 unconsciousness that dominates humans are dominated by Satan's dark matter.


사탄이 만들어낸 혼란 속에서 목사는 하나님의 질서를 회복하기 위해 설교한다. 


불행하게도 사탄의 권력과 돈을 위해 부모를 파는 것은 물질적 욕망이 인간의 기본적인 

도덕성을 압도할 수 있음을 의미합니다. 이는 물질적인 것에 대한 욕구가 무의식적인 수준에서 

강력할 수 있음을 보여줍니다.


우주를 지배하는 95%의 암흑물질처럼, 인간을 지배하는 95%의 본능과 무의식도 사탄의 

암흑물질에 의해 지배되고 있습니다.





Both the constellation Orion and the Pyramids of Giza form planar triangles, but these

 triangles are made up of three points that do not lie on a straight line. These plane 

triangles have certain mathematical relationships in quantum mechanics or the

 Riemann hypothesis to fractions with denominators that are powers of 2 

(1/2, 1/4, 1/8, 1/16, 1/32, 1/64, etc.), and can be used to split triangles. 

The hidden connection between quantum mechanics and the Riemann 

zeta function suggests a relationship between the unconscious realm of

 quantum mechanics and the mathematical structure of the Riemann zeta function.


오리온자리와 기자 피라미드는 모두 평면형 삼각형을 형성하지만 이 삼각형은 직선 위에 있지 않은

 세 개의 점으로 구성됩니다. 이러한 평면 삼각형은 양자 역학 또는 리만 가설에서 분모가

 2의 거듭제곱(1/2, 1/4, 1/8, 1/16, 1/32, 1/64 등)인 분수에 대한 특정 수학적 관계를 

가지며 삼각형을 분할하는 데 사용할 수 있습니다. 양자역학과 리만 제타 함수 사이의 숨겨진

 연관성은 양자역학의 무의식적 영역과 리만 제타 함수의 수학적 구조 사이의 관계를 암시합니다.



There have been attempts to explain the similarities between the Riemann hypothesis's 

zero distribution, prime distribution, and quantum mechanical phenomena by linking

 them to unconscious behavioral patterns, particularly sexual instincts in animals. 

These attempts link the properties of the unconscious, such as disorder, increasing 

entropy, and the passage of time (towards death and the end), and have even led to

 the hypothesis that it can be controlled by dark matter, like gravity or magnetic fields.

리만 가설의 영 분포, 소수 분포, 양자역학적 현상 사이의 유사점을 무의식적인 행동 패턴, 특히 

동물의 성적 본능과 연결하여 설명하려는 시도가 있었습니다. 이러한 시도는 무질서, 엔트로피 

증가, 시간의 흐름(죽음과 종말을 향한) 등 무의식의 특성을 연결하고, 중력이나 자기장과 같은 

암흑물질에 의해 제어될 수 있다는 가설까지 이어졌습니다.







A former high-ranking Satanist confesses, “I performed satanic rituals inside an abortion clinic.”

전직 고위 사탄숭배자는 “낙태클리닉에서 사탄의 의식을 행했다”고 고백한다.


In that particular one, which was probably one of the more heinous abortions I had ever done, the doctor reached in, ripped the baby out and threw it onto the floor where these women were swaying. The women looked like they were possessed, and when the doctor threw the baby out to them, they cannibalized the baby.

 





이것이 내가 참여했던 극악한 낙태 의식들 중에 하나였을 것으로 보이는데, (낙태 수술을 끝낸) 의사가 손을 넣어 아이를 끄집어 낸 뒤 여자들이 몸을 흔들며 주문을 외우는 바닥에 던졌습니다. 그러자 귀신에 들려있는 것으로 보이는 이 여자들은 의사가 던져준 아이를 먹기 시작했습니다.


<After reports of threats to expose the abortion facts to the media and Son Heung-min's family> Won the Europa League title for the first time in 17 years. 17=1+7=8

<낙태 사실을 언론과 손흥민 가족에게 폭로하겠다는 협박 보도 이후> 17년 만에 유로파리그 우승을 차지했다. 17=1+7=8

After being robbed of $500 billion by the Illuminati zombie parasite Trump. 

Strangely, is it a coincidence that the confusing transfer news that has been spreading for over a year is that Son Heung-min has finally moved to the United States?

일루미나티 좀비 기생충 트럼프에게 5천억 달러를 강탈당한 후. 

이상하게도 1년 넘게 퍼지던 혼란스러운 이적 소식이 손흥민이 드디어 미국으로 이적했다는 것이 우연일까요?







Although the direct link between quantum mechanics, Riemann hypothesis, and

 the Pyramids of Giza in Egypt is not an academically proven fact, there are

 theories or interpretations that claim there is a connection in certain 

contexts. In particular, it is true that the unit fraction notation 

(1/2, 1/4, 1/8, 1/16, 1/32, 1/64) was widely used in ancient Egypt and

 was considered a symbol associated with the Eye of Horus.


양자역학과 리만 가설, 이집트 기자 피라미드 사이의 직접적인 연관성은 학술적으로 

입증된 사실은 아니지만, 특정 맥락에서 연관성이 있다고 주장하는 이론이나 해석이 있습니다.

 특히 단위 분수 표기법(1/2, 1/4, 1/8, 1/16, 1/32, 1/64)은 고대 이집트에서 널리 사용되어 

호루스의 눈과 관련된 상징으로 여겨졌던 것이 사실이다.


The Eye of Horus is depicted as being divided into unit fractions: 1/2, 1/4, 1/8, 1/16, 1/32, and 1/64.

호루스의 눈은 1/2, 1/4, 1/8, 1/16, 1/32, 1/64의 단위 분수로 나누어져 있는 것으로 묘사됩니다.


20a4c332e0c021eb3cef84e74688766a9f84aa1aca499600b151451f13bdb42461eed4e674f90e55effb9aadfccf8914bb

7ced8076b5836bf73ce798bf06d6040333a6a55489bd626128

7ced8076b5836bf73ce698bf06d604030f09f072aef194c3f6ab

어떰?

Below is a video promoting Samsung SSD 970 PRO, a storage medium made with NAND flash memory, called the next-generation storage device.
아래는 차세대 저장장치로 불리는 낸드플래시 메모리로 만든 저장매체인 삼성 SSD 970 PRO를 홍보하는 영상이다.

When the SSD 970 PRO is installed on an upside-down pyramid, the pyramid rises and the whole world is connected to the pyramid (computer?).

거꾸로 뒤집힌 피라미드 위에 SSD 970 PRO를 설치하면 피라미드가 올라가고 온 세상이 피라미드(컴퓨터?)로 연결된다.


The Chinese Communist Party worships the red dragon. In the Bible, the big red dragon with seven heads and ten horns <17=1+7=8>

 It symbolizes Satan the devil. In the Bible, red symbolizes sin.

The beast with seven heads and ten horns that appears in the Book of Revelation symbolizes the power of the world that will be destroyed. Of the seven heads of this beast, five have already fallen, one is present, and the final one has not yet appeared but is predicted to appear soon. This last head is interpreted as the 8th king. 17=1+7=8










The moment the pyramid rises, the phrase “the capacity to illuminate a world of ideas” flows out. Here, if the phrase “illuminate a world” is separated out, it can be heard as meaning “enlighten the world” or “create the world of the Illuminati,” so I think it is an intentional scene and phrase.


 


Samsung, a cutting-edge IT company, is taking the lead in turning this world into an Illuminati world (illuminate a(the) world).

 

 

피라미드가 떠오르는 순간 “the capacity to illuminate a world of ideas(아이디어의 세계를 일루미네이트하기(밝히기) 위한 저장력)”이라는 멘트가 흘러나온다. 여기서 “illuminate a world”라는 문구만 따로 띄어 놓으면 “세상을 계몽하라”, 혹은 “일루미나티의 세상을 만들라”는 의미로도 들릴 수 있어 의도적인 장면과 문구라는 생각이 든다.

 

IT의 첨단 기업 삼성이 이 땅을 일루미나티의 세상(illuminate a(the) world)으로 만들어 가는 일에 앞장을 서고 있는 것이다.

?


In fact, it is a symbolic event that Lee Jae-yong and Hong Seok-hyun, the devils of the Republic of Samsung who control the Central Election Management Committee, the National Assembly, the judiciary, and the executive branch of the Republic of Korea, chose Lee Jae-myung. Hong Seok-hyun met Lee Jae-myung and Lee Jae-yong on March 20 (there is a story that the person who actually arranged this meeting was Lee Jae-yong's maternal uncle Hong Seok-hyun). After this meeting, conservative panelists (propagandists of the shadow regime), including Jeong Gyu-je and Jo Gap-je, began to praise Lee Jae-myung all at once, and then on March 26, he was found not guilty in the second trial for violating the election law. I think the timing is too exquisite to be dismissed as a simple coincidence.


사실 대한민국 중앙선거관리위원회, 국회, 사법부, 행정부를 쥐고 있는 삼성공화국의 악마들, 이재용과 홍석현이 이재명을 택한 것은 상징적인 사건입니다.홍석현은 3월 20일 이재명과 이재용을 만났습니다(실제로 이 만남을 주선한 사람이 이재용의 외삼촌 홍석현이었다는 이야기가 있습니다).이 만남 이후 정규제, 조갑제 등 보수 패널(그림자 정권의 선전원)들이 일제히 이재명을 칭찬하기 시작했고, 그러다 3월 26일 선거법 위반 혐의로 2심에서 무죄 판결을 받았습니다.단순한 우연으로 치부하기에는 타이밍이 너무 절묘하다고 생각합니다.



<The presidential election is said to be held on June 3rd. Devil Cockroach Lee Jae-yong Samsung Group affiliates in total 63>

In the multiplication table, 6 x 3 is 18 = 666. 666 is the beast in the Book of Revelation.

<대선이 6월 3일에 치러진다고 합니다. 악마 바퀴벌레 이재용 삼성그룹 계열사 총 63개> 구구단에서 6 x 3은 18 = 666입니다. 666은 요한계시록에 나오는 짐승입니다.


What is truly shocking is that the Constitutional Court, the Republic of Samsung, and the Chinese Communist Party zombie cockroach judges postponed the impeachment trial of Yoon Seok-yeol for one reason.

<63 Samsung Electronics affiliates> In order to meet the presidential election date on June 3

The Constitution stipulates that a presidential election must be held within 60 days of the impeachment.

The impeachment was declared on April 4,

and June 3 is 60 days later.


정말 충격적인 것은 헌법재판소, 삼성공화국, 그리고 중국 공산당 좀비 바퀴벌레 판사들이 윤석열 탄핵 재판을 한 가지 이유로 연기했다는 것입니다.

<삼성전자 계열사 63곳> 6월 3일 대선일을 맞추기 위해

헌법은 탄핵 소추 후 60일 이내에 대선을 치러야 한다고 규정하고 있습니다.

탄핵은 4월 4일에 선포되었고,

6월 3일은 60일 후입니다.






The fact that the pyramid array does not exactly align with the constellation of Orion and appears to be upside down suggests that the pyramid array at Giza in ancient Egypt is similar to the stars of Orion, especially the three stars corresponding to Orion's belt. However, it is pointed out that this arrangement is not completely the same and sometimes appears reversed.


피라미드 배열이 오리온자리와 정확히 일치하지 않고 거꾸로 되어 있는 것처럼 보인다는 사실은 고대 이집트 기자의 피라미드 배열이 오리온의 별, 특히 오리온 허리띠에 해당하는 세 개의 별과 유사하다는 것을 암시합니다. 하지만 이 배열이 완전히 똑같지는 않고 때로는 거꾸로 나타나는 경우도 있다는 지적이 나온다.


The inverted cross is sometimes misused as a symbol of Satanism or anti-Christianity in modern times. In particular, in some cultures, it is used as a tool to blaspheme Jesus Christ or symbolize devil worship.



거꾸로 된 십자가는 현대에 들어 사탄주의나 반기독교의 상징으로 오용되기도 합니다. 특히 일부 문화권에서는 예수 그리스도를 모독하거나 악마 숭배를 상징하는 도구로 사용되기도 합니다.


  The word ‘beast’ appears 36 times in the Book of Revelation. If you reverse 36, it 

becomes 63. 17 financial companies out of 63 affiliates of Samsung Group The beast in 

the Book of Revelation is the beast with seven heads and ten horns, and is also the

 eighth king = 17=1+7=8

요한계시록에는 '짐승'이라는 단어가 36번 나옵니다. 36을 거꾸로 하면 63이 됩니다. 

삼성그룹 63개 계열사 중 17개 금융회사 요한계시록의 짐승은 일곱 머리와 열 뿔 가진

 짐승이요 여덟째 왕이니라 = 17=1+7=8





Lee Jae-myung's Democratic Party primary vote rate was 85.4%=17=1+7=8.

The Democratic Party of Korea secured 170 seats=17=1+7=8 in the National Assembly.

179 deaths at Muan Airport 179=1+7+9=17=1+7=8.

November 25, 2024 = 2+2+4+1+1+2+5=17=1+7=8

Lee Jae-yong, Chairman of Samsung Electronics, Lee Jae-myung, Representative of the Democratic Party of Korea They were found not guilty on the same day. Why can't they be on the same day?

이재명의 민주당 대표경선 득표율은 85.4%=17=1+7=8이었다.

더불어민주당은 국회에서 170석=17=1+7=8석을 확보했다.

무안공항 사망자 179명 179=1+7+9=17=1+7=8.

2024년 11월 25일 = 2+2+4+1+1+2+5=17=1+7=8

이재용 삼성전자 회장 이재명 더불어민주당 대표 그들은 같은 날 무죄 판결을 받았습니다. 왜 같은 날에 있을 수 없나요?




The Chinese Communist Party worships the red dragon. In the Bible, the big red dragon with seven heads and ten horns <17=1+7=8>

 It symbolizes Satan the devil. In the Bible, red symbolizes sin.

The beast with seven heads and ten horns that appears in the Book of Revelation symbolizes the power of the world that will be destroyed. Of the seven heads of this beast, five have already fallen, one is present, and the final one has not yet appeared but is predicted to appear soon. This last head is interpreted as the 8th king. 17=1+7=8



중국 공산당은 붉은 용을 숭배합니다. 성경에 나오는 일곱 머리와 열 뿔을 가진 큰 붉은 용 <17=1+7=8>
 사탄 마귀를 상징합니다. 성경에서 빨간색은 죄를 상징합니다.
요한계시록에 나오는 일곱 머리와 열 뿔 가진 짐승은 멸망할 세상의 권세를 상징합니다. 이 짐승의 일곱 머리 중 다섯은 이미 떨어졌고 하나는 있고 마지막 하나는 아직 나타나지 아니하였으나 곧 나타나리라 예언되었느니라. 이 마지막 머리는 여덟 번째 왕으로 해석됩니다. 17=1+7=8






지난 22일 오후 경기도 부천시 원미구 중동의 한 호텔 화재 현장에서 남녀 투숙객이 추락한 뒤 뒤집혀 있는 에어매트. 연합뉴스





The Chinese are so obsessed with the number '8' that the Beijing Olympics opened at 8pm on August 8, 2008. During the Bucheon Hotel fire terrorist incident, which killed 7 people and injured 19 people in total, the 119 fire department phone number written on the air mattress was upside down. 611=6+1+1=8 Parasite Parasite of the Chinese Communist Party Samsung Republic Lee Jae-yong Zombie Parasite Democratic Party It means that a human sacrifice was offered to Satan in exchange for creating a new order centered around Lee Jae-myung.

중국인들은 숫자 '8'에 너무 집착해서 2008년 8월 8일 오후 8시에 베이징 올림픽이 개막했습니다. 7명이 사망하고 총 19명이 부상당한 부천 호텔 화재 테러 사건 당시 에어 매트리스에 적힌 119 소방서 전화번호가 거꾸로 되어 있었습니다. 611=6+1+1=8 기생충 중국 공산당 기생충 삼성 공화국 이재용 좀비 기생충 민주당 이재명을 중심으로 한 새로운 질서를 만드는 대가로 사탄에게 인간 제물을 바쳤다는 뜻입니다.


Subtitles and images exposed for about 1 second in the MBC News special report during the Muan Airport disaster on December 29th. 817 means 17=1+7=8

12월 29일 무안공항 참사 당시 MBC 뉴스 특보에서 약 1초 정도 노출된 자막과 이미지. 817은 17=1+7=8을 의미합니다.


Muan Airport death toll 179 = 1 + 7 + 9 = 17 = 1 + 7 = 8

무안공항 사망자 179 = 1 + 7 + 9 = 17 = 1 + 7 = 8

▲ 지난 29일 MBC 뉴스 특보에서 1초가량 노출됐던 자막과 이미지.

NVIDIA can resume exporting its artificial intelligence (AI) chip ‘H20’ to China.
According to the Financial Times (FT), on the 8th (local time), the U.S. Department of Commerce's Bureau of Industry and Security began issuing permits to Nvidia to export H20 chips to China.


엔비디아가 인공지능(AI) 칩 'H20'의 중국 수출을 재개할 수 있다.
파이낸셜타임스(FT)에 따르면 지난 8일(현지시각) 미국 상무부 산업안보국은 엔비디아에 H20 칩을 중국으로 수출할 수 있는 허가를 발급하기 시작했다.
Signs of revival for Samsung Semiconductor... Following Tesla, Apple will also take charge of producing next-generation chips.  Jaeyong Lee, the evil parasite, is believed to be the price paid for human sacrifice offered to Satan.
삼성반도체 부활 조짐…테슬라에 이어 애플도 차세대 칩 생산을 맡게 된다.  사악한 기생충 이재용은 사탄에게 인간 제물을 바친 대가로 여겨진다.





Samsung Electronics Vice Chairman Han Jong-hee, who transported fraudulent ballots from China to the United States on Korean Air during the 2020 U.S. presidential election, has passed away at the age of 63. 6 x 3 = 18 = 666

2020년 미국 대선 당시 대한항공을 이용해 중국에서 미국으로 부정투표용지를 운반한 삼성전자 

한종희 부회장이 63세의 나이로 별세했습니다. 6 x 3 = 18 = 666

[서울=뉴시스]이인준 기자 = 한종희 삼성전자 대표이사 부회장이 25일 별세했다. 고인의 빈소는 삼성서울병원 장례식장에 마련됐다. ijoinon@newsis.com

Samsung Electronics Vice Chairman Han Jong-hee passed away from a heart attack. Aged 63. 6 x 3 = 18 = 666 Beast of the Book of Revelation

If Vice Chairman Han Jong-hee Testifies About the 2020 US Presidential Election Fraud

The Moment Samsung and the Chinese Communist Party Collapse

2020 US Presidential Election Fraud: The most important witness among the three Samsung Group officials who transported fraudulent ballots made in China via Korean Air is Samsung Electronics Vice Chairman Han Jong-hee.

삼성전자 한종희 부회장이 심근경색으로 별세했습니다. 향년 63세. 6 x 3 = 18 = 666 요한계시록의 짐승 한종희 부회장이 2020년 미국 대선 부정선거에 대해 증언한다면 삼성과 중국 공산당이 무너지는 순간 2020년 미국 대선 부정선거: 대한항공을 통해 중국에서 제작된 부정투표용지를 운반한 삼성그룹 관계자 3명 중 가장 중요한 증인은 삼성전자 한종희 부회장입니다.


In Chapter 17 of Revelation, the “eighth king” is expressed as “one of the seven kings,” 17=1+7=8

 This is an important symbol that reveals the identity of the beast that will be destroyed. This beast succeeds the previous seven kings and can be interpreted as being identified with them. The fourth beast in Daniel chapter 7 is an apocalyptic depiction, symbolizing destruction and judgment and may be connected to the beast in the Book of Revelation.

요한계시록 17장에서는 “여덟째 왕”을 “일곱 왕 중의 하나”로 표현하는데, 17=1+7=8

 이는 멸망당할 짐승의 정체를 알려주는 중요한 상징이다. 이 짐승은 앞선 일곱 왕의 뒤를 잇는 짐승으로서 그들과 동일시되는 것으로 해석될 수 있습니다. 다니엘 7장에 나오는 네 번째 짐승은 종말론적인 묘사로 멸망과 심판을 상징하며 요한계시록에 나오는 짐승과 연결될 수 있습니다.The divisors of 36 are 1, 2, 3, 4, 6, 9, 12, 18, and 36, and 36 is the 8th triangular number. Therefore, the numbers that are divisors of 36 and are trigonometric numbers are 1, 3, 6, and 36.

The word ‘beast’ appears 36 times in the Book of Revelation. And the ‘number of the beast’ mentioned in Revelation 13:18 is 666. These two are interconnected, which is further emphasized by the calculation that 6 x 6 = 36 and that the numbers 1 through 36 add up to 666.

36의 약수는 1, 2, 3, 4, 6, 9, 12, 18, 36이며, 36은 8번째 삼각수입니다. 따라서 36의 약수이면서 삼각수인 숫자는 1, 3, 6, 36입니다.

요한계시록에는 '짐승'이라는 단어가 36번 등장합니다. 그리고 요한계시록 13장 18절에서 언급되는 '짐승의 숫자'는 666입니다. 이 두 가지는 서로 연결되어 있으며, 6 x 6 = 36 이라는 계산과 1부터 36까지의 수를 모두 더하면 666이 된다는 점을 통해 더욱 강조됩니다.



The word "beast" appears a total of 36 times in the Book of Revelation, and 666 is the 36th triangular number, that is, the sum of all natural numbers from 1 to 36. Therefore, 666 can be said to be a triangular number among triangular numbers. 요한계시록에는 '짐승'이라는 단어가 총 36번 등장하는데, 666은 36번째 삼각수, 즉 1에서 36까지의 모든 자연수를 합한 수입니다. 따라서 666은 삼각수 중 삼각수라고 할 수 있습니다.


Trump shows a bruise on his right hand

오른손에 멍자국이 보이는 트럼프 



It is no coincidence that the sixth prime number in the Satanic Beast hierarchy program is 13. In this way, the number 13 symbolizes the attributes of the snake and red dragon of the Antichrist, who oppose God's work of creation and salvation. Illuminati Numerology 13 is an important number symbolizing the Satanic Serpent and the Red Dragon.


사탄짐승의 서열 프로그램에서 여섯 번째 소수가 13인 것은 우연이 아니다. 이처럼 13이라는 숫자는 하나님의 창조와 구원의 역사를 반대하는 적그리스도의 뱀과 붉은 용의 속성을 상징한다. 일루미나티 수비학 13은 사탄의 뱀과 붉은 용을 상징하는 중요한 숫자입니다.

The angle of rotation during one cycle of precession is 360 degrees. Precession refers to the phenomenon in which the axis of rotation of a rotating object rotates in a cone shape around another axis. At this time, the time it takes for the rotation axis to rotate once is one cycle, and during this one cycle, the rotation axis rotates 360 degrees.

세차 운동의 한 주기 동안 회전 각도는 360도입니다. 세차운동이란 회전하는 물체의 회전축이 다른 축을 중심으로 원뿔 모양으로 회전하는 현상을 말합니다. 이때, 회전축이 1회전하는데 걸리는 시간은 1사이클이고, 이 1사이클 동안 회전축은 360도 회전하게 된다.

Rotate 360 degrees as the Earth rotates once a day

지구가 하루에 한 번 자전하면서 360도 회전합니다.

The twisted shape of DNA shows ‘rotational symmetry’. Even if you turn it 360 degrees, the same pattern repeats itself.

DNA의 뒤틀린 모양은 '회전대칭'을 나타냅니다. 360도 돌려봐도 같은 패턴이 반복됩니다.


The helical structure of DNA is a mathematically perfect geometric shape. This is called a ‘double helix’. 

The angles and spacing of this spiral are also very precise. Rotates approximately 36 degrees per rotation


DNA의 나선형 구조는 수학적으로 완벽한 기하학적 모양입니다. 이를 '이중 나선'이라고 합니다. 

이 나선의 각도와 간격도 매우 정확합니다. 1회전당 약 36도 회전



Your description of the Pyramids of Giza, Egypt is correct. The Giza Pyramids are located approximately 13 km from downtown Cairo. The entrance is twisted 3.6 degrees to the northeast and is located 13 stories high.


이집트 기자 피라미드에 대한 귀하의 설명이 정확합니다. 기자 피라미드는 카이로 시내에서 약 13km 떨어져 있습니다. 입구는 북동쪽으로 3.6도 비틀어져 있으며 높이는 13층이다.





The word "beast" appears a total of 36 times in the Book of Revelation, and the number 666 is widely interpreted to symbolize Satan. In particular, the description of beasts appears intensively in Chapter 13.





요한계시록에는 짐승이라는 단어가 총 36번 나오며, 666이라는 숫자는 사탄을 상징하는 것으로 널리 해석된다. 특히 13장에는 짐승에 대한 묘사가 집중적으로 등장한다.


In Feng Shui, Ganbang (艮方) refers to the northeast (0 to 45 degrees) and is generally considered an inauspicious direction. 

The northeast direction of the Giza Pyramids is offset from Earth's true north by about 3.6 degrees. This means that the pyramids were not built to point exactly north. However, this does not necessarily mean that it is an error. It is possible that the ancient Egyptians did not base themselves on the exact North Pole, but used a different reference point.

풍수에서 간방(艮方)은 북동쪽(0~45도)을 말하며 일반적으로 불길한 방향으로 여겨진다. 

기자 피라미드의 북동쪽 방향은 지구의 진북에서 약 3.6도 오프셋되어 있습니다. 이는 피라미드가 정확히 북쪽을 향하도록 건설되지 않았음을 의미합니다. 그러나 이것이 반드시 오류임을 의미하는 것은 아닙니다. 고대 이집트인들은 정확한 북극을 기준으로 삼지 않고 다른 기준점을 사용했을 가능성이 있습니다.Currently, the tariff rate for Illuminati zombie parasite Samsung Semiconductor is 0%... 


Satan Zombie Illuminati Avatar Child Rapist Trump said 'soon' but that's not clear either.


현재 일루미나티 좀비기생충 삼성반도체 관세율은 0%… 


사탄 좀비 일루미나티 아바타 아동 강간범 트럼프가 '곧'이라고 말했지만 그것도 확실하지 않습니다.


According to the law of entropy, the body ages and heads towards death, but the mind seeks meaning and purpose and seeks to grow. In particular, mental growth is achieved through pain, and it suggests that physical pain, like Jesus' suffering on the cross, can be a catalyst for mental growth. This is an insight that explains the meaning of pain in relation to the law of entropy. In addition, the adage “Never discuss life with someone who has not tasted the bread of tears” emphasizes that the experience of pain adds depth to life and leads to maturity.






엔트로피의 법칙에 따르면 몸은 늙어 죽음을 향해 나아가지만, 마음은 의미와 목적을 추구하며 성장을 추구한다. 특히 정신적 성장은 고통을 통해 이루어지며, 예수님의 십자가 고난처럼 육체적 고통도 정신적 성장의 촉매제가 될 수 있음을 시사한다. 이는 고통의 의미를 엔트로피 법칙과 연관시켜 설명하는 통찰이다. 또한 “눈물의 빵을 맛보지 않은 사람과는 인생을 논하지 말라”는 속담은 고통의 경험이 삶에 깊이를 더해주고 성숙으로 이어진다는 점을 강조하고 있습니다.



Satan, Illuminati, Zombies, Demons, Child Rapist Trump knows full well that no leader of any country other than the Samsung Republic and Chinese Communist Zombie Parasite President Lee Jae-myung would sell their country for $500 billion in loan debt.

사탄, 일루미나티, 좀비, 악마, 아동 성폭행범 트럼프는 삼성공화국과 중국 공산당 좀비기생충인 이재명 대통령 외에는 어떤 나라의 지도자도 5000억 달러의 대출 빚에 조국을 팔지 않을 것임을 잘 알고 있다.







<Blue House, $350 billion investment fund “Do not invest directly, but borrow the entire amount”>

That's not an investment 

Being robbed of $350 billion by Trump 





It is estimated that Illuminati Rockefeller parasite zombie Trump will dispose of $350 billion in loan debt guaranteed by the Chinese Communist Party zombie parasite Lee Jae-myung's government and sell 90% of the profits and bonds used by the United States to the Chinese Communist Party at half the price.


<청와대, 3500억달러 투자펀드 “직접 투자하지 말고 전액 차입”>

그건 투자가 아니지 

트럼프에게 3500억 달러 강탈당했다 




일루미나티 록펠러 기생충 좀비 트럼프는 중국 공산당 좀비 기생충 이재명 정부가 보증한 대출채무 3500억 달러를 처분하고 미국이 사용하는 이윤과 채권의 90%를 절반 가격에 중국 공산당에 매각할 것으로 추정된다.


The target of the Trump tariff show scenario was Korea from the beginning. 


Behind the fraudulent election of Chinese Communist Party zombie Lee Jae-myung, there are Illuminati parasite zombies, a show of Rockefeller and Blackrock zombies, the United States, China, and the Samsung Republic.


트럼프 관세쇼 시나리오의 타깃은 처음부터 한국이었다. 


중국 공산당 좀비 이재명의 부정선거 뒤에는 일루미나티 기생충 좀비, 록펠러와 블랙록 좀비의 쇼, 미국과 중국, 삼성공화국이 있다.


It is assumed that Japan has no intention of actually signing the document. Lee Jae-myung is scheduled to visit the United States on the 25th to sign the document.




It is assumed that no country other than Korea's Lee Jae-myeong will sign the slave document. Even if Canada and Switzerland face tariffs of more than 35%, they do not sign because it is better than making a 500 billion dollar guaranteed loan.


일본은 실제로 해당 문서에 서명할 의사가 없는 것으로 추정된다. 이재명은 문서 서명을 위해 25일 미국을 방문할 예정이다.




노예문서에는 한국의 이재명 외에는 어떤 나라도 서명하지 않을 것으로 추정된다. 캐나다와 스위스는 35%가 넘는 관세에 직면하더라도 5000억 달러 보증 대출을 해주는 것보다 낫다는 이유로 서명하지 않는다.

Samsung Alba Yoon Seok-yeol martial law show 

 What is the purpose of the impeachment show of Samsung Zombie Han Dong-hoon and Ko Dong-jin, former head of Samsung Electronics' IM division and CEO? 

 It is presumed that the purpose is to sell out Korea by having Lee Jae-myung, a Chinese communist zombie, elected through fraudulent elections.

삼성알바 윤석열 계엄령 쇼 

 삼성좀비 한동훈과 고동진 전 삼성전자 IM부문장 겸 CEO 탄핵소추의 목적은 무엇일까. 

 중국 공산 좀비 이재명을 부정선거로 당선시켜 한국을 팔아치우려는 목적이 있는 것으로 추정된다.


총격 때 트럼프 감싸안은 경호원들 웃고 있네?…이 사진 정체는

After the assassination attempt on former U.S. President Donald Trump, doctored photos spread and various conspiracy theories arose.
도널드 트럼프 전 미국 대통령에 대한 암살 시도 이후 조작된 사진들이 확산되고 각종 음모론으로 떠들썩하다.

Trump is said to have learned the secret of tricking people with pig blood while appearing on a professional wrestling show.

트럼프는 프로레슬링 쇼에 출연하면서 돼지 피로 사람을 속이는 비법을 배웠다고 한다.








Impact investment sparked by Blackrock Chairman’s letter – Weekly Chosun
It is known that the word ‘impact investment’ was first used at the Rockefeller Foundation conference held in Bellagio, Italy in 2007. The Rockefeller Foundation later began creating an ecosystem by supporting the establishment of the Global Impact Investment Network (GIIN).”

블랙록 회장 서한으로 촉발된 임팩트투자 – 주간조선
임팩트 투자라는 단어는 2007년 이탈리아 벨라지오에서 열린 록펠러 재단 컨퍼런스에서 처음 사용된 것으로 알려져 있다. 이후 록펠러 재단은 글로벌 임팩트 투자 네트워크(GIIN) 설립을 지원하며 생태계 조성에 나섰다.”

What should be noted here is that BlackRock, the world's largest asset management company that manages assets worth 10 trillion dollars (14,000 trillion won), is acting as an evangelist beyond following the policies of the Rockefeller Foundation. BlackRock can be seen as a financial company influenced by the Rockefeller family.

Rockefeller is behind BlackRock, which oversaw the Trump assassination show.
여기서 주목해야 할 점은 10조 달러(14,000조 원) 규모의 자산을 관리하는 세계 최대 자산운용사 블랙록이 록펠러 재단의 정책을 따르는 것을 넘어 전도사 역할을 하고 있다는 점이다. 블랙록은 록펠러 가문의 영향을 받은 금융회사로 볼 수 있다.

록펠러는 트럼프 암살 쇼를 감독한 BlackRock의 배후에 있습니다.


2022년 글로벌 자산운용사 블랙록 광고에 출연한 트럼프 전 대통령 총격 용의자 크룩스. /X(옛 트위터)
Crooks, the suspect in the shooting of former President Trump, appeared in a 2022 advertisement for global asset management company BlackRock. /X (formerly Twitter)

In the photo above, Crooks did not shoot Trump. 
The demons killed Crooks beforehand and were set up by the Rockefeller-controlled Black Rock demons at the site where Crooks' body was found.

Illuminati Triad Zombie Trump Run by Rockefeller Foundation

트럼프 전 대통령 총격 사건의 용의자 크룩스는 글로벌 자산운용사 블랙록의 2022년 광고에 등장했다. /X(이전 트위터)

위 사진에서 크룩스는 트럼프를 쏘지 않았습니다. 
악마들은 사전에 Crooks를 죽였고 Rockefeller가 통제하는 Black Rock 악마들에 의해 Crooks의 시신이 발견된 장소에 설치되었습니다.

록펠러 재단이 운영하는 일루미나티 트라이어드 좀비 트럼프

Roger Penrose said that the probability of a universe in which life could exist is 10 to the power of 123.

Rockefeller zombies Blackrock and Trump believe they can fool the world and Jesus Christ with pig blood  
What a foolish imbecile.
로저 펜로즈는 생명체가 존재할 수 있는 우주가 존재할 확률은 10의 123승이라고 말했습니다.

록펠러 좀비 블랙록과 트럼프는 돼지 피로 세상과 예수 그리스도를 속일 수 있다고 믿는다  
정말 어리석은 바보입니다.

If you look at the media and broadcast politicians who say that it is natural for Korea to do this because more than 90% of the money Japan invested in the United States is being stolen, they are less intelligent than dogs and pigs.

일본이 미국에 투자한 돈의 90% 이상이 도둑질을 당하니 한국이 이렇게 하는 게 당연하다고 말하는 언론과 방송 정치인들을 보면 개돼지보다 지능이 떨어진다.

Japan also claims that it is a slave contract in which the United States accounts for more than 90% of the profits, but the actual investment amount is only 1-2%, which is why it is believed that Japan was used as bait to trap Korea.

일본 역시 미국이 이익의 90% 이상을 차지하는 노예계약이라고 주장하지만 실제 투자금액은 1~2%에 불과해 일본이 한국을 함정에 빠뜨리는 미끼로 이용됐을 것으로 추정된다.


It is assumed that Japan has no intention of actually signing the document. Lee Jae-myung is scheduled to visit the United States on the 25th to sign the document.




It is assumed that no country other than Korea's Lee Jae-myeong will sign the slave document. Even if Canada and Switzerland face tariffs of more than 35%, they do not sign because it is better than making a 500 billion dollar guaranteed loan.


일본은 실제로 해당 문서에 서명할 의사가 없는 것으로 추정된다. 이재명은 문서 서명을 위해 25일 미국을 방문할 예정이다.




노예문서에는 한국의 이재명 외에는 어떤 나라도 서명하지 않을 것으로 추정된다. 캐나다와 스위스는 35%가 넘는 관세에 직면하더라도 5000억 달러 보증 대출을 해주는 것보다 낫다는 이유로 서명하지 않는다.


Even if Satan, zombies, Rockefeller, Blackrock, zombie parasites, and Trump impose 200% tariffs, slave contracts must be canceled unconditionally.

사탄, 좀비, 록펠러, 블랙록, 좀비기생충, 트럼프가 200% 관세를 부과하더라도 무조건 노예계약을 해지해야 한다.



Currently, Samsung Semiconductor's tariff rate is 0%... However, high tariffs are imposed on Chinese semiconductors... The same goes for smartphones and PCs.

Trump says 'soon,' but it will take at least two to three months, but that's not certain either.

현재 삼성반도체 관세율은 0%인데… 중국 반도체에 높은 관세 부과… 스마트폰, PC도 마찬가지다.

트럼프는 '곧'이라고 말하지만 적어도 2~3개월은 걸릴 것인데 그것도 확실하지 않다.

IT products such as Samsung Semiconductors were originally subject to a 0% tariff in accordance with the Information Technology Agreement (ITA).


삼성반도체 등 IT제품은 정보기술협정(ITA)에 따라 당초 0% 관세를 적용받았다.


<Blue House, $350 billion investment fund “Do not invest directly, but borrow the entire amount”>

Chinese Communist Party zombie parasite Lee Jae-myung, tell him that it is trash. It is absolutely not an investment, but is the same as donating $350 billion to Illuminati Rockefeller parasite zombie Trump.

<청와대, 3500억달러 투자펀드 “직접 투자하지 말고 전액 차입”>

중국 공산당 좀비 기생충 이재명, 쓰레기라고 말해라. 절대 투자는 아니지만 일루미나티 록펠러 기생충 좀비 트럼프에게 3,500억 달러를 기부하는 것과 같습니다.

A fund is a financial product that pools funds collected by investors and invests them in various assets such as stocks, bonds, and real estate, and distributes the profits to investors. Simply put, indirect investment products, in which many people's money is collected and invested by experts on their behalf, are relatively easy to manipulate accounting and create illegal slush funds.

펀드는 투자자가 모은 자금을 모아 주식, 채권, 부동산 등 다양한 자산에 투자하고, 그 수익을 투자자에게 분배하는 금융상품입니다. 쉽게 말하면 전문가가 많은 사람의 돈을 모아 투자하는 간접투자 상품은 상대적으로 회계조작이 쉽고 불법 비자금 조성이 쉽다.




Currently, the yen still maintains some of its status as a reserve currency, and the won is not a reserve currency, so it is not subject to direct comparison. Additionally, Japan's GDP is about 2.7 times larger than Korea's.

현재 엔화는 여전히 기축통화로서의 지위를 일부 유지하고 있고, 원화는 기축통화가 아니기 때문에 직접적인 비교 대상은 아니다. 게다가 일본의 GDP는 한국보다 약 2.7배 더 크다.

If the Korean government guarantees the loan, the Illuminati will lend $500 billion. 

Rockefeller Zombie Parasite Trump Steals 90% of $350 Billion in Profit 


 If you can't repay, the devils will sell the bonds to the Chinese Communist Party and take over Korea.

한국 정부가 대출을 보증하면 일루미나티는 5000억 달러를 빌려준다. 

록펠러 좀비 기생충 트럼프, 3,500억 달러 수익 중 90% 훔쳐 


 갚지 못하면 마귀들이 그 채권을 중국 공산당에 팔아 한국을 점령할 것입니다.

Secretary Rutnick explained, “90% of the $350 billion in revenue will go to the American people.”러트닉 장관은 “3500억 달러 수입의 90%가 미국 국민에게 돌아갈 것”이라고 설명했다.

미국 상무부 장관 하워드 러트닉이 지난달 5일(현지시각) 워싱턴 디시(D.C.) 캐피톨 힐에서 열린 하원 세출위원회 청문회에 출석해 도널드 트럼프 미국 대통령의 상무부 예산 요청안에 대해 증언하고 있다. 워싱턴/로이터 연합뉴스


Even if Satan, zombies, Rockefeller, Blackrock, zombie parasites, and Trump impose 200% tariffs, slave contracts must be canceled unconditionally.

사탄, 좀비, 록펠러, 블랙록, 좀비기생충, 트럼프가 200% 관세를 부과하더라도 무조건 노예계약을 해지해야 한다.


The only countries with which the United States signed slave contracts using 90% of its investment were Korea and Japan, and the United States met with Japan four times in advance to create a scenario in which the devil Trump used this as bait to trap Korea.

In fact, it is said that Japan can invest 1-2% of the total investment amount.

미국이 투자금의 90%를 활용해 노예계약을 맺은 나라는 한국과 일본뿐이었고, 미국은 일본과 4차례나 사전에 만나 악마 트럼프가 이를 미끼로 한국을 가두는 시나리오를 만들었다.

실제로 일본은 전체 투자금액의 1~2%만 투자할 수 있다고 한다.


In particular, Japan cannot be compared with Japan because it is a reserve currency country and Korea's GDP is 2.7 times the size.

특히 일본은 기축통화 국가이고, 국내총생산(GDP) 규모가 한국의 2.7배에 달해 일본과 비교할 수 없다.

If the Korean government guarantees the loan, the Illuminati will lend $500 billion. 

Trump steals 90% of $350 billion in profits 


 If you can't repay, the devils will sell the bonds to the Chinese Communist Party and take over


The explanation is that policy financial institutions will be mobilized to provide comprehensive support for investment, loans, and guarantees.


To put it simply, in return for the Illuminati lending 350 billion dollars, the Korean government guarantees the loan, and if it cannot repay, sells the bonds to the Chinese Communist Party.

Of course, I can't pay the loan. 

The Chinese army is taking over Korea.


정책금융기관을 동원해 투자, 대출, 보증 등을 종합적으로 지원하겠다는 설명이다.


쉽게 말하면 일루미나티가 3,500억 달러를 빌려준 대가로 한국 정부가 대출을 보증하고, 갚지 못할 경우 그 채권을 중국 공산당에 파는 방식이다.

물론 대출금을 갚을 수는 없습니다. 

중국군이 한국을 점령하고 있습니다.



$350 billion is similar to giving it to the United States for free, and the purchase price of LNG is $150 billion, a total of $500 billion.

3500억 달러는 미국에 무상으로 주는 것과 비슷한 액수로, LNG 구매금액은 1500억 달러로 총 5000억 달러다.


Korea's foreign exchange reserves amount to $410 billion

한국 외환보유액 4,100억 달러



If you give 350 billion dollars to the US and the US takes 90% of the profits, this is not investment, it is robbery. This is not negotiation, it is robbery. Even if the tariffs are 200%, you should never negotiate.

미국에 3500억 달러를 줬는데 그 이익의 90%를 미국이 가져가면 그건 투자가 아니라 강도다. 이건 협상이 아니라 강도입니다. 

관세가 200%라고 하더라도 절대 협상하면 안 됩니다.

$350 billion 

U.S. Commerce Secretary Howard Rutnick announced on the 30th, “The United States will take 90% of the profits from Korean investment funds from the United States.” Regarding this, the Blue House said, “We understand that it is a reinvestment concept.”

who lies


3,500억 달러 

하워드 러트닉 미국 상무장관은 30일 “미국은 한국 투자펀드 수익의 90%를 미국에서 가져갈 것”이라고 밝혔다. 이에 대해 청와대는 “재투자 개념인 것으로 알고 있다”고 밝혔다.

누가 거짓말을 하는가



In particular, Korea's core technological shipyards will be relocated to the United States, Illuminati companies such as Samsung and Hyundai will also complete their relocation to the United States, and the Chinese Communist Army's landing operation will begin.

특히 한국의 핵심 기술 조선소가 미국으로 이전되고 삼성, 현대 등 일루미나티 기업들도 미국으로 이전을 완료하고 중국 공산군의 상륙 작전이 시작될 예정이다.


지금 재생 중










Samsung Electronics Devil Chairman Lee Jae-yong and Zombie Democratic Party Representative Lee Jae-myung Meeting Date


March 20, 2025 = 2+2+5+3+2=14=1+4=5


삼성전자 악마 이재용 회장과 좀비 민주당 이재명 의원 회동 날짜


2025년 3월 20일 = 2+2+5+3+2=14=1+4=5

Satan Zombie Cockroach Chinese Communist Party Flag has 4 small stars and 1 large star Satan Lucifer Evil Spirit Symbol

사탄 좀비 바퀴벌레 중국 공산당 깃발에는 작은 별 4개와 큰 별 1개가 있습니다. 사탄 루시퍼 악령 상징




<Illuminati Numerology 5> 4 elements (earth, air, water, fire) + Lucifer's light World ruled by Lucifer, total = 5 To the general public, the number 5 means death. But Satan's zombies symbolize blessing and protection. The changes in the movement of all things in the universe are based on the principle of energy, which is a basic and universal principle, and the four basic forces of nature known so far (strong nuclear force, weak nuclear force, and electromagnetic force). . . and gravity) 4 and +1 are caused by the action of only one force i.e. dark matter = satan lucifer the devil = 5 forces.

<일루미나티 수비학 5>

4원소(흙, 공기, 물, 불) + 루시퍼의 빛 루시퍼가 통치하는 세계, 합계 = 5 일반 대중에게 숫자 5는 죽음을 의미합니다. 하지만 사탄의 좀비들은 축복과 보호를 상징합니다.

우주 만물의 움직임의 변화는 기본적이고 보편적인 원리인 에너지의 원리와 지금까지 알려진 자연의 4가지 기본 힘(강핵력, 약한 핵력, 전자기력). . . 및 중력) 4와 +1은 단 하나의 힘, 즉 암흑 물질 = 사탄 루시퍼 악마 = 5개의 힘의 작용으로 인해 발생합니다.

Satan Zombie Purchases Itaewon Land in Seoul in the Name of the Chinese Government 4162㎡ = 4 + 1 + 6 + 2 = 13 = 1 + 3 = 4

(Approximately 1256 pyeong) 1 + 2 + 5 + 6 = 14 = 1 + 4 = 5

Major Events in Korean Numerology Liberation Day 8.15 = 14 = 1 + 4 = 5

4.19 = 4 + 1 + 9 = 14 = 1 + 4 = 5

5.18 = 5 + 1 + 8 = 14 = 1 + 4 = 5

Yoon Seok-yeol Martial Law Army Memorial Day: December 3, 2024 = 14 = 5

Impeachment Bill Passes the National Assembly 14 days.

Singer Tani (real name Kim Jin-soo), who sang a song commemorating the Sewol ferry disaster, died in a car accident on the morning of April 14, 2018.



Among the Itaewon terrorist attacks, the foreign victims were from 14 countries.

The foreign victims of the Itaewon terrorist attacks were from 14 countries.

14=1+4=5

사탄 좀비, 중국 정부 명의로 서울 이태원 땅 매입 4162㎡ = 4 + 1 + 6 + 2 = 13 = 1 + 3 = 4

(약 1256평) 1 + 2 + 5 + 6 = 14 = 1 + 4 = 5

한국 수비학 주요 사건 광복절 8.15 = 14 = 1 + 4 = 5

4.19 = 4 + 1 + 9 = 14 = 1 + 4 = 5

5.18 = 5 + 1 + 8 = 14 = 1 + 4 = 5

윤석열 계엄군 현충일: 2024년 12월 3일 = 14 = 5

탄핵안 국회 통과 14일 만

세월호 참사를 추모하는 노래를 불렀던 가수 타니(본명 김진수)가 2018년 4월 14일 오전 교통사고로 사망했습니다.



이태원 테러 사건의 외국인 희생자는 14개국 출신이었습니다.

이태원 테러의 외국인 희생자는 14개국 출신이었습니다.

14=1+4=5



November 22, President Kennedy's assassination

11월 22일, 케네디 대통령 암살



 Samsung Group Chairman Lee Kun-hee's


 youngest daughter Lee Yoon-hyung (27


 years old) = 2 + 7 = 9 Funeral: November


 22, 2005

삼성그룹 이건희 회장의 막내딸 이윤형(27세) = 2 + 7 = 9 장례: 2005년 11월 22일




November 22, 2005 = 2+5+1+1+2+2=13th Luminati Numerology

2005년 11월 22일 = 2+5+1+1+2+2=13일루미나티 수비학 


Lee Yoon-hyung's Funeral Date November 22, 2005 = 2+5+1+1+2+2=13 Illuminati Numerology


Lee Yoon-hyung was 27 years old at the time =


2+5+1+1+2+2=13+2+7=22


Lee Jae-yong, the cunning devil who killed Lee Yoon-hyung by guessing the Illuminati Numerology, Samsung Electronics Chairman Lee Jae-yong

이윤형 장례일 2005년 11월 22일 = 2+5+1+1+2+2=13 일루미나티 수비학


이윤형은 당시 27세였습니다 =


2+5+1+1+2+2=13+2+7=22


이재용, 일루미나티 수비학을 맞혀 이윤형을 죽인 교활한 악마, 삼성전자 이재용 회장


November 19, 2005, 3:00 AM = 2+5+1+1+1+9+3=22 Lee Yoon-hyung, the youngest daughter of Samsung Group Chairman Lee Kun-hee. Two days later, she was cremated at a crematorium and offered as a sacrifice to the devil who leads the second beast.

2005년 11월 19일 오전 3시 = 2+5+1+1+1+9+3=22 삼성그룹 이건희 회장의 막내딸 이윤형. 이틀 후, 그녀는 화장터에서 화장되어 둘째 짐승을 이끄는 악마에게 제물로 바쳐졌습니다.





January 9, 2019 = Samsung Group Cheil Industries-YG Entertainment launch fashion brand 'Nonagon' On January 9, 2019, just before the Burning Sun incident became serious, the collaboration suddenly ended. =


2019-01-09=


2+1+9+1+9=22


2019년 1월 9일 = 삼성그룹 제일모직-YG엔터테인먼트, 패션 브랜드 '노나곤' 론칭 2019년 1월 9일, 버닝썬 사태가 본격화되기 직전, 갑작스럽게 협업이 종료되었습니다. =

2019-01-09=

2+1+9+1+9=22


22=2+2=4. This is the number that symbolizes the 22 seasons of the Tree of Life. The 22nd letter in Roman numerals is V. V means 5 in Roman numerals, and 5 symbolizes the pentagram, which symbolizes the head of Baphomet.

22=2+2=4. 이는 생명나무의 22계절을 상징하는 숫자입니다. 로마 숫자로 22번째 글자는 V입니다. V는 로마 숫자로 5를 의미하며, 5는 바포멧의 머리를 상징하는 오각형을 상징합니다.


1 John 2:22 KJV

Who is the liar but he who denies that Jesus is the Christ? He who denies

the Father and the Son is the antichrist.

요한일서 2:22 KJV 예수께서 그리스도이심을 부인하는 자가 아니고 누가

거짓말쟁이입니까? 아버지와 아들을 부인하는 자가 곧 적그리스도니라.

1 Kings 22:22 Then he answers: ‘I will be a lying spirit in the mouth of all the

prophets of Ahab, and I will cause them all to lie.’ The LORD said, ‘You are

enticing him, and you will surely succeed.’ Go and do it now.'

열왕기상 22:22

그런 다음 그는 대답합니다. 내가 아합의 모든 선지자들의 입 속에 거짓말하는 영이 되어 그들을 다 거짓말하게 하리라 하셨나니 여호와께서 이르시되 네가 그를 꾀느니라 확실히 성공할 것입니다. 가서 당장 해라.'

Ephesians 2:2, “In which you at that time walked according to the course of

this world, according to the prince of the power of the air, a spirit that now

works in the sons of disobedience.”

에베소서 2장 2절, “그 때에 너희가 그 가운데 행하여 이 세상 풍속을 좇고 공중의

권세 잡은 자를 따랐으니 곧 지금 불순종의 아들들 가운데서 역사하는 영이니라.”




It is a situation that makes us suspect that Samsung and the Chinese Communist Party's parasitic zombie terrorists secretly edited the airplane's black box for 4 minutes.

Who would believe that the black box suffered from amnesia for 4 minutes? Who would believe that Jeju Air claimed that they deleted 4 minutes of video and recorded footage at the same time? = 2+2=4





삼성과 중국 공산당의 기생 좀비 테러리스트들이 비행기 블랙박스를 4분 동안 비밀리에 편집했을 것이라는 의심을 불러일으키는 상황입니다.

블랙박스가 4분 동안 기억상실증에 걸렸다고 누가 믿겠습니까?

제주항공이 4분 분량의 영상과 녹화 영상을 동시에 삭제했다고 주장했는데 누가 믿겠습니까?

= 2+2=4


Since the betrayal of Judas Iscariot occurred at the Last Supper in the upper room of Mark where 13 people were gathered, the number 13 is believed to contain the meaning of distrust, betrayal, curse, and judgment. It can also be seen as the ‘number of Satan’, which was the beginning of the betrayal of Judas Iscariot (Luke 22:3).

가룟 유다의 배신은 마가복음의 다락방에서 13명이 모인 최후의 만찬에서 일어났기 때문에, 13이라는 숫자는 불신, 배신, 저주, 심판을 의미한다고 여겨집니다. 또한 가룟 유다의 배신의 시작이었던 '사탄의 숫자'로도 볼 수 있습니다(누가복음 22:3).

13 is the sixth prime number. What does the sixth number, 13, have to do with 6? In conclusion, 6 refers to humans who were created on the sixth day, and symbolizes the fall of humans.


13은 여섯 번째 소수입니다. 여섯 번째 숫자인 13은 6과 무슨 관련이 있을까요? 결론적으로, 6은 여섯째 날에 창조된 인간을 가리키며, 인간의 타락을 상징합니다.



"And the beast opened its mouth to blaspheme God, to blaspheme his name and his tabernacle, and those who dwell in heaven" (Rev. 13:6)


Regarding the mark of the beast, which is the symbol of the Antichrist, Revelation 13 records that the 'name of the beast' or 'the number of the beast' is the 'number of a man', and '666' (six hundred and sixty-six).

"짐승이 입을 벌려 하나님을 모독하고 그의 이름과 그의 장막과 하늘에 거하는 자들을 모독하더라"(계 13:6)


적그리스도의 상징인 짐승의 표에 관하여, 요한계시록 13장은 '짐승의 이름' 또는 '짐승의 숫자'가 '사람의 숫자'와 '666'(육백육십육)이라고 기록합니다.


In particular, Revelation 13 records the number of the beast as 666, the number of a man (Revelation 13:17-18). The one who entered Judas Iscariot and betrayed Jesus was also Satan (Luke 22:3). 

The core pyramid of the Riemann hypothesis is the beast program of Satan Lucifer, who rules the material world. 


Illuminati numerology claims that the number of days is connected to the prime numbers 2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31. 

It is no coincidence that 13 is the sixth prime number. In this way, 13 symbolizes the attributes of the antichrist serpent and the red dragon who oppose God's creation and salvation work.


특히 요한계시록 13장은 짐승의 수를 사람의 수인 666으로 기록합니다(요한계시록 13:17-18). 가룟 유다에게 들어가 예수님을 배반한 자 역시 사탄이었습니다(누가복음 22:3).

리만 가설의 핵심 피라미드는 물질 세계를 지배하는 사탄 루시퍼의 짐승 프로그램입니다.


일루미나티 수비학은 날 수가 소수 2, 3, 5, 7, 11, 13, 17, 19, 23, 29, 31과 연결되어 있다고 주장합니다.

13이 여섯 번째 소수인 것은 우연이 아닙니다. 이처럼 13은 하나님의 창조와 구원 사역에 반대하는 적그리스도 뱀과 붉은 용의 속성을 상징합니다


Although the direct link between quantum mechanics, Riemann hypothesis, and the Pyramids of Giza in Egypt is not an academically proven fact, there are theories or interpretations that claim there is a connection in certain contexts. In particular, it is true that the unit fraction notation (1/2, 1/4, 1/8, 1/16, 1/32, 1/64) was widely used in ancient Egypt and was considered a symbol associated with the Eye of Horus.


양자역학과 리만 가설, 이집트 기자 피라미드 사이의 직접적인 연관성은 학술적으로 입증된 사실은 아니지만, 특정 맥락에서 연관성이 있다고 주장하는 이론이나 해석이 있습니다. 특히 단위 분수 표기법(1/2, 1/4, 1/8, 1/16, 1/32, 1/64)은 고대 이집트에서 널리 사용되어 호루스의 눈과 관련된 상징으로 여겨졌던 것이 사실이다.


The Eye of Horus is depicted as being divided into unit fractions: 1/2, 1/4, 1/8, 1/16, 1/32, and 1/64.

호루스의 눈은 1/2, 1/4, 1/8, 1/16, 1/32, 1/64의 단위 분수로 나누어져 있는 것으로 묘사됩니다.


20a4c332e0c021eb3cef84e74688766a9f84aa1aca499600b151451f13bdb42461eed4e674f90e55effb9aadfccf8914bb

7ced8076b5836bf73ce798bf06d6040333a6a55489bd626128

7ced8076b5836bf73ce698bf06d604030f09f072aef194c3f6ab

어떰?











Inquiries are continuing about the meaning of the MBC exit poll countdown video for the 21st general election held on April 15, the day before the 6th anniversary of the Sewol ferry incident. 


세월호 참사 6주기를 하루 앞둔 4월 15일 실시된 21대 총선 MBC 출구조사 카운트다운 영상의 의미에 대한 문의가 이어지고 있다. 


​​





A little girl reminiscent of the Sewol Ferry victims rides a paper boat and is guided by a rabbit, navigating the rough waters of democratization toward a new world.


세월호 희생자들을 연상시키는 어린 소녀는 종이배를 타고 토끼의 인도를 받으며 민주화의 험난한 물살을 헤치고 새로운 세계를 향해 나아갑니다.






The water droplets coming out of the large boat on either side of the small paper boat were intentionally designed to cover one of the rabbit's eyes.  It shows that the force that threw the girl into cold water (the mastermind of the Sewol Ferry incident, the rabbit) is the Illuminati who serve the one-eyed Horus.

For reference, Lee Jae-myung was born in 1963, the year of the rabbit.



작은 종이배 양쪽의 큰 배에서 나오는 물방울은 토끼의 눈 중 하나를 가리도록 의도적으로 디자인되었습니다.  소녀를 찬물에 빠뜨린 세력(세월호 사건의 주모자, 토끼)이 외눈박이 호루스를 섬기는 일루미나티임을 보여준다.

참고로 이재명은 1963년 토끼띠 해에 태어났다.




Two pillar-shaped lighthouses appear in front of the girl who lost her oar in the rough current, leading her to a new world (New World Order?).



​거친 물살에 노를 잃어버린 소녀 앞에 두 개의 기둥 모양의 등대가 나타나 새로운 세상(New World Order?)으로 인도한다.


A girl discovers a rabbit lying on the altar of the Capitol in the water.

한 소녀가 물 속에서 국회의사당 제단에 누워 있는 토끼를 발견합니다.

When the girl touches the rabbit, it turns into yellow water droplets and rises to the ground.
소녀가 토끼를 만지면 토끼는 노란색 물방울로 변해 땅으로 솟아오릅니다.

​Yellow water droplets rise into the sky and change into various colors, showing the appearance of a whale (an animal or beast coming up from the sea?) dancing.
It feels like a symbol of Korea being occupied by the Chinese Communist Party.

​노란색 물방울이 하늘로 솟아오르며 다양한 색으로 변하면서 고래(바다에서 올라오는 동물이나 짐승?)가 춤추는 모습을 보여준다.
마치 중국 공산당이 한국을 점령하고 있다는 상징 같은 느낌이다.


Yellow has many meanings in Chinese culture, and is considered an important color, especially associated with the emperor. Yellow symbolizes gold, wealth, authority, neutrality and good luck, and is also associated with the Yellow River, the birthplace of Chinese civilization. Additionally, yellow is also used in the Chinese national flag, the Five-Star Red Flag, to represent the Chinese people's ideology of being the chosen people.



노란색은 중국 문화에서 많은 의미를 가지며, 특히 황제와 관련된 중요한 색으로 간주됩니다. 노란색은 금, 부, 권위, 중립, 행운을 상징하며 중국 문명의 발상지인 황하와도 연관되어 있습니다. 또한 노란색은 중국 국기인 오성홍기에도 사용되어 중국인이 선택받은 민족이라는 이념을 나타냅니다.










 


(일루미나티의 상징 )






(세월호 참사 세모그룹의 전신 오대양의 피라미드 전시안 로고)






(참좋은 여행사 , 삼천리 자전거의 전신 기아산업 초창기 로고)




(참좋은 여행 계열사 삼천리 자전거의 로고)




(666과 3 이 보인다.)











It is a pattern of three numbers connected. 

666 The Pyramid of Antichrist is known as a mystical symbol.



(Pyramid Threequetra symbol)

 It symbolizes the Trinity of Osiris + Isis + Horus (Orion + Sirius + Nibiru).

세 개의 숫자가 연결되어 있는 패턴입니다. 

666 적그리스도의 피라미드는 신비로운 상징으로 알려져 있습니다.



(피라미드 Threequetra 기호)

 오시리스 + 이시스 + 호루스(오리온 + 시리우스 + 니비루)의 삼위일체를 상징합니다.





Trump learned how to use pig blood as a trick during his professional wrestling days.

트럼프는 프로 레슬링 시절 돼지 피를 트릭으로 사용하는 방법을 배웠습니다.





Beasts who even use God and Jesus Christ for their own economic and political gain.

자신의 경제적, 정치적 이익을 위해 하나님과 예수 그리스도까지 이용하는 짐승들입니다.




2





viewimage.php?no=24b0d769e1d32ca73dec81fa11d028314d3faebecfec25ed6aa779bc7a56f30fc1a560061d33f58e596face9c6a2c525a97d7c7dc27c9c00bd5f78eaed5e3be0d2baeaf64e57b5d57c3b58a1254ac52837eea23ff8ed65b3002b2f2eee2099edd67a36c405a01




 

Evidence has emerged that Samsung Electronics Vice Chairman Lee Jae-yong murdered his youngest half-sister and lied about her death in a car accident.

삼성전자 이재용 부회장이 자신의 가장 어린 이복 여동생을 살해하고 교통사고로 사망했다는 사실을 거짓말했다는 증거가 드러났습니다.


 Looking at the photo below, why was the contract to board the Ohamana, which is known to be relatively safe, suddenly changed to the Sewol, which is at risk of sinking?

아래 사진을 보면, 상대적으로 안전하다고 알려진 오하마나호 탑승 계약이 갑자기 침몰 위험이 있는 세월호로 변경된 이유는 무엇일까요?



There are claims that the Sewol Ferry incident and the 1987 Odaeyang mass suicide incident were planned by the Salvation Sect and the Illuminati subcontractor Samsung Republic, which instigated them.


세월호 사건과 1987년 오대양 집단자살 사건이 구원파와 이를 사주한 일루미나티 하청업체 삼성리퍼블릭에 의해 기획되었다는 주장이 있습니다.



 구조대원들이 언딘 사의 바지선에서 구조작업을 벌이고 있다.

<Reporter Joo Jin-woo said, "The Coast Guard spoke to Samsung, and the Coast Guard gave me the phone number of Director Kim A-mu of Undin." Cheonghaejin Marine had no prior knowledge of Undin, and even wrote Undin as 'Unbin' on the documents.>

When I think about it, the Sewol was planned by the Illuminati subcontractor Samsung Republic, and introducing Undin to the Coast Guard is also the hidden power of Korea, Samsung Republic. That's why I think of it.


<주진우 기자는 "해경이 삼성 측과 통화했고, 해경이 운딘의 김아무 이사 전화번호를 알려줬다"고 밝혔습니다. 청해진해운은 운딘에 대한 사전 지식이 전혀 없었고, 심지어 문서에 운딘을 '운빈'이라고까지 적었습니다.>

생각해 보니 세월호는 일루미나티 하청업체인 삼성공화국이 기획했고, 운딘을 해경에 소개한 것도 한국의 숨겨진 힘, 삼성공화국의 힘입니다. 그래서 그런 생각이 드는 겁니다.


The Chief of Naval Operations sent the Navy Special Forces as rescue workers by order of the President, but the only one behind this bizarre power structure where a private company controls the Coast Guard and Navy is the Republic of Samsung.


해군참모총장은 대통령의 명령으로 해군특전단을 구조대원으로 파견했지만, 민간기업이 해경과 해군을 통제하는 이 기괴한 권력구조 뒤에 숨은 주체는 삼성공화국 뿐입니다.


Undine is a company that received attention when it was selected as a rescue company during the Sewol ferry sinking. It also participated in the search operation during the Cheonan incident, but it was revealed that it received hundreds of millions of won in fees without any significant results, which caused controversy.


운다인은 세월호 침몰 사고 당시 구조 업체로 선정되어 주목을 받았던 기업입니다. 천안함 사건 당시 수색 작업에도 참여했지만, 별다른 성과 없이 수억 원의 수수료를 받은 사실이 드러나 논란을 일으켰습니다.




Rescue or sabotage rescue?


 


Why did Undine, who has a contract with Cheonghaejin Shipping, a company specializing in salvage rather than rescue, take charge of the rescue activities?  Was there no will for rescue from the beginning?



구조 또는 방해 행위 구조?


 


구조보다는 인양 전문업체인 청해진해운과 계약을 맺은 운디네가 구조 활동을 맡게 된 이유는 무엇일까.  처음부터 구조하겠다는 의지가 없었나요?



It was revealed that the background to the conflict between private divers and the government during the rescue operation of the missing people from the Sewol ferry was the private company ‘Undine Marine Industries’ (Undine), which had signed a contract with Cheonghaejin Shipping and led the rescue operation at the site. For this reason, it is being pointed out that there has been a shift from a public-private-military cooperation system in which the government is responsible for even disaster relief to a privatization system in which the government is responsible for entrusting it to private companies.



세월호 실종자 구조 작업 과정에서 민간잠수부와 정부가 갈등을 빚게 된 배경에는 청해진해운과 계약을 맺고 현장 구조작업을 주도한 민간업체 '언디네해양산업(운디네)'이 있었던 것으로 밝혀졌다. 이 때문에 재난 구호까지 정부가 책임지는 민관협력 체제에서 민간기업에 맡기는 민영화 체제로 전환됐다는 지적이 나온다.





In response to Kim Gura’s question, “It is said that the captain did not give an evacuation order, was it the captain’s sole decision?” he responded, “That is still a question. “The captain himself issued an evacuation order, but according to the survivor’s testimony, no one heard the order to abandon ship,” he raised a question.



김구라의 질문에 “선장이 대피 명령을 내리지 않았다고 하는데 선장이 단독으로 결정한 것이냐”고 말했다. 그는 "아직도 의문이다"라며 "선장이 직접 대피 명령을 내렸는데, 생존자의 증언에 따르면 배를 버리라는 명령을 아무도 듣지 못했다"고 물었다.



Lee Cheol-hee explained, "It has not yet been identified, but Captain Lee Jun-seok worked on a one-year contract. He would have been the so-called 'Barge Captain'. In fact, he would not have had the authority to control the ship. I think there would have been one full-time employee with real power. That person would have made decisions through phone calls with the ship owner, etc."



이철희는 "아직 확인된 바는 없지만 이준석 선장은 1년 계약으로 일했다. 소위 '바지선 선장'이었을 것이다. 사실 배를 조종할 권한은 없었을 것이다. 실질적인 권력을 가진 정규직 직원이 한 명 있었을 것 같다. 그 사람이 선주 등과 전화 통화를 통해 결정을 했을 것"이라고 설명했다.


The Riemann hypothesis is a conjecture that all real parts of non-trivial roots of the Riemann zeta function are 1/2. In other words, the real part of the complex root that causes the Riemann zeta function to be 0 is always 1/2.

리만 가설은 리만 제타 함수의 자명하지 않은 근의 실수부가 모두 1/2이라는 추측입니다. 즉, 리만 제타 함수를 0으로 만드는 복소수 근의 실수 부분은 항상 1/2이라는 것입니다. 



In the picture of the Eye of Horus, 1/2 represents one part of the entire eye when divided into two parts. This figure is related to the unit fractions used in ancient Egypt, where each part of the eye is represented by a fraction of 1/2, 1/4, 1/8, 1/16, 1/32, and 1/64. Here 1/2 refers to the left part of the eye.



호루스의 눈 그림에서 1/2은 두 부분으로 나누어졌을 때 눈 전체의 한 부분을 나타냅니다. 이 수치는 고대 이집트에서 사용된 단위 분수와 관련이 있는데, 눈의 각 부분은 1/2, 1/4, 1/8, 1/16, 1/32, 1/64의 분수로 표시됩니다. 여기서 1/2은 눈의 왼쪽 부분을 의미합니다.


The movie Cloud Atlas, released in 2013, also tells the story of the main character (Tom Hanks) taking on a mission to save humanity after losing his left eye.


2013년 개봉한 영화 '클라우드 아틀라스' 역시 주인공(톰 행크스)이 왼쪽 눈을 잃은 후 인류를 구하는 임무를 맡는 이야기를 담고 있다.











Hollywood, which is in charge of promoting the Illuminati's agenda, is repeatedly instilling in the public the message that "Horus, the hero who lost one eye, will save the world" through recently released movies.


 


What is interesting is that in Zechariah 11:17, which is known to be a prophecy about the Antichrist, the Antichrist is described as being wounded in one arm and one eye.









일루미나티의 어젠다 홍보를 담당하고 있는 할리우드는 최근 개봉한 영화들을 통해 “한쪽 눈을 잃은 영웅 호루스가 세상을 구할 것이다”라는 메시지를 대중에게 거듭 심어주고 있다.


 


흥미로운 점은 적그리스도에 대한 예언으로 알려진 스가랴 11장 17절에 적그리스도가 한쪽 팔과 한쪽 눈에 상처를 입은 것으로 묘사되어 있다는 점이다.





“Woe to you, the wicked shepherd, who forsakes the flock! The sword will come on his arm and on his right eye, and his arm will be completely dry, and his right eye will be completely dark.”


 


The Bible confirms the fact that the one-eyed Horus that world governmentists (Illuminati) are waiting for is the Antichrist, described as a “bad shepherd who abandoned his flock.”


“화 있을진저 악한 목자여 양떼를 버린 자여 칼이 그 팔과 오른쪽 눈에 임하리니 그의 팔이 완전히 마르고 그의 오른쪽 눈이 완전히 어두워지리라.”


 


세계정부주의자(일루미나티)가 기다리고 있는 외눈박이 호루스가 “양떼를 버린 나쁜 목자”로 묘사되는 적그리스도임을 성경은 확증한다.







 The Illuminati Triad Society was organized under the patronage of David Rockefeller (former CFR president) at the Rockefeller Mansion on July 1, 1972. Seok-Hyeon Hong: He served as vice-chairman of the Asia-Pacific Committee from 2012 to 2019. Member of Samsung Electronics Dirty Devil Chairman Lee Jae-yong

일루미나티 삼합회는 1972년 7월 1일 록펠러 맨션에서 데이비드 록펠러(전 CFR 회장)의 후원으로 조직됐다. 홍석현 : 2012년부터 2019년까지 아시아태평양위원회 부의장을 역임했다. 삼성전자 더러운 악마 회장 이재용 회원




In 1909, a person believed to be a black child is shown being tied up and moved for ritual.

1909년, 흑인 어린이로 추정되는 사람이 의식에 씌여지기 위해 묶여서 이동 중인 모습.




Bohemian Grove Satan

As the Molexin ritual continued for a while, fire flew in front of the owl statue along with the devil's scream and it fell, Satan

The evil ritual of human sacrifice to Molexin reaches its peak. Photo: Alex Jones

보헤미안 그로브 사탄 몰렉신 의식이 한동안 계속되자 악마의 비명과 함께 부엉이 조각상 앞으로 불이 날아와서 쓰러졌다, 사탄 몰렉신에게 인간을 제물로 바치는 사악한 의식이 정점에 달합니다. 사진: 알렉스 존스









viewimage.php?id=23b0d8&no=24b0d769e1d32ca73cef83fa11d02831a8a78790708c2166b82f7ce95d9e30b56e1b33a7f46a3b3e1b6e08800c7a82489a08f5cc560a5c620f958

Alex jones immediately exposed this on his show program, and of course, interest was proven through hundreds of thousands of views on YouTube. Alex Jones also surprises and interviews Republican Congressman David Gergen, an important person who participated in this, and embarrasses him. That's right. The Bohemian groove ritual that made the Republican Party leader so embarrassed that he even ran away in anger later on was part of the MOLECH faith that had been handed down since ancient times. The MOLECH faith appears in the Old Testament of the Bible and was a very cruel custom in the Canaan region that involved sacrificing children to a god statue, setting it on fire, and letting it fall into the flames.

Alex jones는 이것을 바로 자신의 쇼프로그램에서 폭로했고 유튜브에선 당연히 수십만건의 조회수를 통해 그 관심도를 증명했다. 알렉스 존스는 게다가 여기에 참여한 중요인사인 공화당 의원 David Gergen을 기습적으로 인터뷰해서 그를 쩔쩔매게 만든다.

그렇다. 공화당 실세였던 그가 그렇게 쩔쩔매다 못해 나중엔 화까지 내며 자리에서 도망치게 만든 그 보헤미안 그루브의 의식은 바로 고대로부터 내려오던 MOLECH 신앙의 일부였다. 몰렉(MOLECH)신앙은 성서의 구약에도 나오며, 어린이를 신상에 바치고, 불을 피워 화염 속에 그 아래로 떨어지게 하는 매우 잔인한 가나안 지방의 풍속이었다.





The Trilateral Society was organized at the Rockefeller Mansion on July 1, 1972, under the patronage of David Rockefeller (former CFR president). Seok-Hyeon Hong: He served as vice-chairman of the Asia-Pacific Committee from 2012 to 2019. Samsung Electronics Devil member Chairman Lee Jae-yong


삼극협회는 1972년 7월 1일 록펠러 맨션에서 데이비드 록펠러(전 CFR 회장)의 후원으로 조직되었습니다. 홍석현: 2012년부터 2019년까지 아시아태평양위원회 부의장을 역임했다. 삼성전자 악마 이재용 회장 회원



 Photo Caption: History of the Sambyeonhoe Logo

사진설명: 삼변회 로고의 역사








You need to know about the Trilateral Commission. The abbreviation for the Triangular Committee is called Sambyeonhoe. The English spelling is ‘Trilateral Commission’. This organization was founded by David Rockefeller (President of Chase Manhattan Bank), the youngest of the four Rockefeller brothers, a member of the Illuminati, and was formed by members of the American, Japanese, and European parliaments, business community, academia, and media. Just as you can see the number 666 on the Rockefeller Building in New York, Rockefeller used 666 as the logo (mark) of the Trilateral Committee in the early days.

삼각위원회(三角委員會, Trilateral Commission)를 알고 넘어가야 한다. 삼각위원회(三角委員會)의 약칭을 삼변회라고 한다. 영문 표기는 ‘Trilateral Commission’이다. 이 조직의 창립은 일루미나티 멤버인 록펠러의 4형제 중에 막내인 데이비드 록펠러(체이스 맨해턴 은행 총재)가 미국과 일본, 유럽의 의회, 재계, 학계, 언론계 등으로 구성하여 만든 조직이었다. 뉴욕의 록펠러 빌딩에서 666숫자를 확인할 수 있는 것처럼 록펠러는 초창기에 삼각위원회(삼변회)의 로고(마크)를 666으로 사용했었다.



However, as controversy arose in some quarters, the number 666 was slightly modified and the current logo (666) was used. Even today, the Rockefeller Building has a neon sign with the number 666.

The triangular committee consists of the European Group, North American Group, and Pacific Asia Group. There is a Pacific Asia Group, and Samsung Electronics Chairman Lee Jae-yong is also a member.

그러나 일각에서 논란이 일자 666이라는 숫자를 약간 수정해 현재의 로고(666)를 사용하게 됐다. 오늘날에도 록펠러 빌딩에는 666이라는 숫자의 네온사인이 있습니다. 삼각위원회는 유럽그룹, 북미그룹, 태평양아시아그룹으로 구성된다. 퍼시픽아시아그룹이 있고, 이재용 삼성전자 회장도 회원이다.


The Trilateral Society was organized at the Rockefeller Mansion on July 1, 1972, under the patronage of David Rockefeller (former CFR president). Seok-Hyeon Hong: He served as Vice Chairman of the Asia-Pacific Committee from 2012 to 2019.

삼극협회는 1972년 7월 1일 록펠러 맨션에서 데이비드 록펠러(전 CFR 회장)의 후원으로 조직되었습니다. 홍석현: 2012년부터 2019년까지 아시아태평양위원회 부의장을 역임했다.




Meeting of pro-Moon Jae-in core forces The group name is ‘Owl’.

친문재인 핵심세력 모임 그룹명은 '부엉이'다.






The ‘owl group’ protecting Moon Jae-in is causing controversy.

Source: Media Today (https://www.mediatoday.co.kr)

문재인을 보호하는 '부엉이 집단'이 논란을 일으키고 있다. 출처 : 미디어투데이(https://www.mediatoday.co.kr)




An owl was used in the logo of Family Express, operated by JoongAng Ilbo. The owl is the logo of Bohemian Grove and a symbol of Molexin, the symbol of Satan's human sacrifice. In the case of Samsung, there are places where pyramids are built.

중앙일보에서 운영하는 패밀리익스프레스의 로고에 부엉이를 사용하였습니다. 부엉이는 보헤미안 그로브의 로고이자 사탄의 인간 희생의 상징인 몰렉신의 상징입니다. 삼성의 경우 피라미드를 쌓는 곳이 있다.



Hong Seok-hyun, Samsung Electronics Chairman Lee Jae-yong's maternal uncle, received a master's degree in industrial engineering and a doctorate in economics from Stanford University in the United States. He worked as an economist at the World Bank (IBRD) from 1977 to 1983 and as a research fellow at the Korea Development Institute (KDI) from 1985 to the following year.

이재용 삼성전자 회장의 외삼촌 홍석현 씨는 미국 스탠퍼드대에서 산업공학 석사와 경제학 박사 학위를 받았다. 1977년부터 1983년까지 세계은행(IBRD)에서 경제학자로 일했고, 1985년부터 이듬해까지 한국개발연구원(KDI)에서 연구원으로 일했다.





In 1994, Hong Seok-hyun, vice president and CEO of JoongAng Ilbo, took office. He was promoted to president in March of the following year, and became chairman of JoongAng Ilbo in 1999.

1994년 홍석현 중앙일보 부사장이 취임했다. 이듬해 3월 사장으로 승진했고, 1999년 중앙일보 회장이 됐다.





2 3 5 7 11 13 17 19 23 29 31 37… Riemann Hypothesis Satan Pyramid Idolatry ‘Law of the Few’ Hierarchy of Beasts Pyramid Stairs The Bible knows exactly that the 6th prime number is 13. 성경은 6번째 소수가 13이라는 것을 정확히 알고 있습니다.


“666,” which is “the number of the beast” and “the number of man,” is a unique word that appears only in Chapter 13 of the Book of Revelation.

“짐승의 수”이면서 “사람의 수인 666”은 요한계시록 13장에만 등장하는 독특한 단어이다.

The devil Lee Jae-yong planned the Itaewon massacre and human sacrifices just two days after taking office as chairman of Samsung Electronics.

Making people receive the 666 mark of the beast is an imitation of the book of Revelation called the second beast.

악마 이재용은 삼성전자 회장에 취임한 지 이틀 만에 이태원 학살과 인간 제물을 계획했다.

 666 짐승의 표를 받게 하는 것은 둘째 짐승이라 불리는 요한계시록을 모방한 것이다.


It was this second beast that caused people to receive the mark of the beast (666) (verses 16-18).

사람들에게 짐승의 표(666)를 받게 하는 것은 바로 이 두 번째 짐승이었다(16-18절).





Demon Jae-yong Lee promoted to Chairman of Samsung Electronics on October 27, 2022 2+2+2+1+2+7=16=8+8

2022년 10월27일 삼성전자 회장으로 승진한 악마 이재용

2+2+2+1+2+7=16=8+8





Satanic human sacrifice in Itaewon massacre two days after the inauguration of Samsung Electronics Chairman Lee Jae-yong October 29, 2022 = 18 = 666

이재용 삼성전자 회장 취임 이틀 만에 이태원 학살에 악마적 인간희생 2022년 10월 29일 = 18 = 666







Satan recharges his energy through human sacrifice.


Dark matter exists as a sacrifice to other living beings.


The human body is made of evil dark matter.


Matter changes into various forms over time.


Humans trapped in Satan's dark matter are also sinners who live by killing other living beings and creating energy. All humans are sinners.


Thanks to Jesus Christ, humans can be forgiven for their sins. Time is set.


Why Time is Precious


사탄은 인간 희생을 통해 자신의 에너지를 재충전합니다.


암흑 물질은 다른 생명체를 위한 희생 제물로 존재합니다.


인간의 몸은 사악한 암흑 물질로 이루어져 있습니다.


물질은 시간이 지남에 따라 다양한 형태로 변화합니다.


사탄의 암흑 물질에 갇힌 인간 또한 다른 생명체를 죽이고 에너지를 만들어내며 살아가는 죄인입니다. 모든 인간은 죄인입니다.


예수 그리스도 덕분에 인간은 죄를 용서받을 수 있습니다. 시간은 정해져 있습니다.


시간이 소중한 이유





Girls' Generation song <Gee>


I thought of it after seeing the post




I was convinced after seeing the bbq logo

소녀시대 노래 <Gee>


게시글 보고 생각났어요




bbq 로고 보고 확신했어요


1ebec223e0dc2bae61abe9e74683766c7fe7cd88f7b45c272c8b6b000a9f23fb68c4fe6ce76a29f523b854483c84fea4




Satan Zombie Illuminati Samsung Demons can make the mark of the beast 666 left by the second beast in Revelation 13 by flipping it upside down or turning it sideways without using 6. 

The alphabet <abdegpq> can also be made with 6.


사탄 좀비 일루미나티 삼성 악마들은 요한계시록 13장에 나오는 두 번째 짐승이 남긴 짐승 666의 표를 6을 사용하지 않고 거꾸로 뒤집거나 옆으로 돌려서 만들 수 있습니다.


알파벳 <abdegpq>도 6을 사용하여 만들 수 있습니다.

1ebec223e0dc2bae61abe9e74683766c7fe7c888f6b3592d2d866b1724bc32dce87fbafd8f1b2d3cae6ab3a49f1ac3f6b644


In the photo of the people who died in the Itaewon terrorist attack, people are covered with yellow blankets with a picture of a bee drawn on them, so the "bee" represents 666.

이태원 테러로 사망한 사람들의 사진에서 사람들은 벌 그림이 그려진 노란색 담요를 덮고 있는데, 여기서 '벌'은 숫자 666을 상징합니다.


In Korea, you have to take off your shoes to enter a room.


It is said that human sacrifice includes taking off your shoes and socks as a sign of allegiance to Satan.


The Itaewon terrorist victims also covered their bodies with 666 blankets.


It is said that demons take off their shoes and bow before corpses as a sign of allegiance to Satan.

한국에서는 방에 들어가려면 신발을 벗어야 합니다.


인간 희생에는 사탄에게 충성하는 표시로 신발과 양말을 벗는 것이 포함된다고 합니다.


이태원 테러 희생자들은 666장의 담요로 몸을 가렸습니다.


악마들이 사탄에게 충성하는 표시로 신발을 벗고 시체 앞에 절한다고 합니다.





Why are the powerful nations such as the United States, Japan, Norway, France, and Austria so cowardly silent about the fact that their own citizens were sacrificed to Satan in the Itaewon terrorist attack?


The governments and people of the countries that were massacred also have a duty to reveal the truth about the incident.


미국, 일본, 노르웨이, 프랑스, ​​오스트리아 등 강대국들이 이태원 테러에서 자국민이 사탄에게 희생되었다는 사실에 대해 왜 그토록 비겁하게 침묵하는 걸까?






<Itaewon terror, offering sacrifices to Satan and demanding material blessings to save Samsung Semiconductor.

Samsung Republic demon zombies who offer humans as sacrifices in exchange for Satan's blessings to allow election fraud, which is the core of money and power

This is the Samsung Republic that demands material blessings and protection from Satan, who rules the material world.>


<이태원 테러, 사탄에게 제물을 바치고 삼성 반도체를 구하기 위해 물질적 축복을 요구하다.

돈과 권력의 핵심인 선거 부정을 허용하기 위해 사탄의 축복을 받는 대가로 인간을 제물로 바치는 삼성 공화국 악마 좀비들.

이것이 물질 세계를 지배하는 사탄으로부터 물질적 축복과 보호를 요구하는 삼성 공화국이다.>

159 people were massacred and human sacrifices were offered to Satan 1+5+9=15=1+5=6 Dark forces numerology beast number 666 October 29, 2022 Among the 159 victims of the Itaewon terror attack By nationality, the 26 foreign deaths include 5 Iranians, 4 Chinese, 4 Russians, 2 Americans, 2 Japanese, 1 each from France, Australia, Norway, Austria, Vietnam, Thailand, Kazakhstan, Uzbekistan, and Sri Lanka. It's a name. ​ October 27, 2022, two days after Samsung Electronics Chairman Lee Jae-yong's inauguration ceremony October 29, 2022 = 2+2+2+1+2+9=18=666 Itaewon terrorist plot massacre 159 people sacrificed to Satan


159명이 학살당하고 사탄에게 인신공양이 바쳐짐 1+5+9=15=1+5=6 어둠의 세력 수비학 짐승 숫자 666 2022년 10월 29일 이태원 테러 사건 희생자 159명 중 국적별로 보면 외국인 사망자 26명은 이란인 5명, 중국인 4명, 러시아인 4명, 미국인 2명, 일본인 2명, 프랑스인 1명, 호주인 1명, 노르웨이인 1명, 오스트리아인 1명, 베트남인 1명, 태국인 1명, 카자흐스탄인 1명, 우즈베키스탄인 1명, 스리랑카인 1명씩이다. 이름이다. ​ 2022년 10월 27일, 이재용 삼성전자 회장 취임식 이틀 후 2022년 10월 29일 = 2+2+2+1+2+9=18=666 이태원 테러 음모 학살 159명이 사탄에게 제물로 바쳐짐

Samsung Republic boss, the devil Lee Jae-yong, who imitates the second beast in the Book of Revelation

요한계시록에 나오는 두 번째 짐승을 흉내내는 악마, 삼성 리퍼블릭 사장 이재용


Lee Jae-yong, Chairman of Samsung Electronics, Inauguration Ceremony October 27, 2022 = 2+2+2+1+2+7=16=8+8

이재용 삼성전자 회장 취임식 2022년 10월 27일 = 2+2+2+1+2+7=16=8+8

Revelation 13:16 records that the beast "causes all, both small and great, rich and poor, free and slave, to receive a mark on their right hand or on their foreheads." In other words, the beast forces everyone, especially small and great, rich and poor, free and slave, to receive the mark of the beast.

요한계시록 13장 16절은 짐승이 "작은 자나 큰 자나, 부자나 가난한 자나, 자유인이나 종이나 다 오른손이나 이마에 표를 받게 한다"고 기록합니다. 다시 말해, 짐승은 모든 사람, 특히 작은 자나 큰 자나, 부자나 가난한 자나, 자유인이나 종이나 모두에게 짐승의 표를 받게 한다는 것입니다.

October 27, 2022 Two days after the inauguration of Samsung Electronics Chairman Lee Jae-yong, October 29, 2022 = 2+2+2+1+2+9=18=666 Itaewon terrorist attack plan massacre 159 people sacrificed to Satan

2022년 10월 27일 삼성전자 이재용 회장 취임 이틀 후인 2022년 10월 29일 = 2+2+2+1+2+9=18=666 이태원 테러 계획 학살 159명 사탄에게 제사


Revelation 13:18 says, "Here is wisdom. Let him who has understanding calculate the number of the beast, for it is the number of a man, and his number is Six hundred and threescore and six.

요한계시록 13장 18절은 이렇게 말합니다. "지혜가 여기에 있습니다. 총명한 자는 그 짐승의 숫자를 세어 보십시오. 그것은 사람의 숫자이며, 그의 숫자는 육백육십육입니다.

image



The scene of the ‘Itaewon disaster’. There was someone wearing a strange costume.

Photos of them doing something strange, similar to a sacrificial ritual, and the police seeming to be helping them.





<In Seoul, I met Erik Evensen and Susanna Roalkvam, Norwegian bereaved families of the Itaewon disaster victims. Erik and Susanna are the parents of the late Stine Roalkvam Evensen, a victim of the Itaewon disaster. They came to Korea on October 29, 2023, the first anniversary of the Itaewon disaster.>





<I don't even know what the Korean government didn't do. (There is a Foreign Ministry official in charge.) I don't remember anything. Susanna Roalkbaum / Mother of the late Stine Evensen, a victim of the Itaewon disaster. We are in a completely dark room with no information. No one from the Korean embassy or the Foreign Ministry has contacted us about the Itaewon disaster.


<서울에서 이태원 참사 희생자 노르웨이 유가족인 에릭 에벤센과 수잔나 로알크밤을 만났습니다. 에릭과 수잔나는 이태원 참사 희생자인 고 스틴 로알크밤 에벤센의 부모입니다. 두 분은 이태원 참사 1주기인 2023년 10월 29일에 한국에 오셨습니다.>





<한국 정부가 무엇을 하지 않았는지조차 모르겠습니다. (외교부 관계자가 담당하고 있습니다.) 아무것도 기억나지 않습니다. 수잔나 로알크밤 / 이태원 참사 희생자인 고 스틴 에벤센의 어머니. 우리는 아무런 정보도 없이 완전히 어두운 방에 있습니다. 한국 대사관이나 외교부 관계자 중 누구도 이태원 참사에 대해 저희에게 연락하지 않았습니다.











Devils who slippery avocado oil on narrow, steep alleys

좁고 가파른 골목길에 미끄러운 아보카도 오일을 뿌리는 악마들






a14004ab062eb45d9e3323519d02f0b125bbcebcc5892e6187fe1f516d17e213854d09b6c9190bf3a0df19


Police collect shoes from 159 victims of Itaewon 'devil human sacrifice'

Why take your shoes off and collect them?

경찰, 이태원 '악마인간제물' 피해자 159명 신발 수거 신발을 벗고 수집하는 이유는 무엇입니까?



In Islam, shoes are considered dirty. If you want to quickly escalate a situation in the Arab world, just say, "I'll throw your shoes at you."





If you throw shoes, Muslims can be seriously offended. This sensitivity towards shoes is because shoes are considered very unclean in the Muslim faith. Just as Muslims are required to remove their shoes before praying, wearing shoes inside a mosque is strictly forbidden. Shoes should be left at the mosque door or carried by yourself. When carrying shoes, hold both pairs carefully with your left hand.




Itaewon terrorist victims' shoes and socks taken off. Shoes stained with avocado oil and other substances. Samsung Republic's demon zombie police cover up all evidence.


이슬람에서는 신발을 더러운 것으로 여깁니다. 아랍 세계에서 상황을 빠르게 악화시키고 싶다면 "신발을 던져버리겠다"라고 말하세요.


신발을 던지면 무슬림들은 심각한 모욕감을 느낄 수 있습니다. 신발에 대한 이러한 민감성은 무슬림 신앙에서 신발을 매우 부정한 것으로 여겨지기 때문입니다. 무슬림이 기도하기 전에 신발을 벗어야 하는 것처럼, 모스크 안에서 신발을 신는 것은 엄격히 금지되어 있습니다. 신발은 모스크 문에 두거나 직접 들고 가야 합니다. 신발을 운반할 때는 왼손으로 신발과 양말을 조심스럽게 잡으세요.





이태원 테러 희생자들의 신발과 양말이 벗겨져 있습니다. 아보카도 오일과 기타 물질로 얼룩진 신발. 삼성그룹의 악마 좀비 경찰이 모든 증거를 은폐하고 있습니다.







(Seoul = Yonhap News) Reporter Ryu Young-seok = Yongsan-gu Office staff are disinfecting the alley of Itaewon, Yongsan-gu, Seoul, where the Itaewon disaster occurred on the 11th. (November 11, 2022, 12:21) A Yongsan-gu Office staff member is cleaning up traces of the Chinese Communist Party's terrorist drug fentanyl and avocado oil that were sprinkled on a sloped floor.



The police who concealed evidence of the Avocado oil-stained shoes in the Itaewon massacre were accomplices.(서울=연합뉴스) 류영석 기자 = 용산구청 직원들이 11일 이태원 참사가 발생한 서울 용산구 이태원 골목길을 소독하고 있다. (2022년 11월 11일 12시 21분) 용산구청 직원들이 경사진 바닥에 뿌려진 중국 공산당의 테러용 마약인 펜타닐과 아보카도 오일의 흔적을 청소하고 있다. 이태원 참사 당시 아보카도 오일이 묻은 신발의 증거를 은폐한 경찰이 공범이었다.


In Korea, you have to take off your shoes to enter a room.

It is said that human sacrifices include taking off your shoes and socks as a sign of allegiance to Satan.

The bodies of the victims in the Itaewon terrorist attack were covered with a 666 blanket.

The demon zombies take off their shoes and bow before the bodies as a sign of allegiance to Satan.

한국에서는 방에 들어가려면 신발을 벗어야 합니다.

인간 제사에는 사탄에게 충성을 맹세하는 표시로 신발과 양말을 벗는 것이 포함된다고 합니다.

이태원 테러 사건 희생자들의 시신에는 666 담요가 덮여 있었습니다.

악마 좀비들은 사탄에게 충성을 맹세하는 표시로 신발을 벗고 시신 앞에 절합니다.







1ebec223e0dc2bae61abe9e74683766c7fe7c888f6b3592d2d866b1724bc32dce87fbafd8f1b2d3cae6ab3a49f1ac3f6b644

Girls Generation song <gee>

I thought of it after seeing the post

I was convinced after seeing the <bbq> logo


소녀시대 노래 <지>


게시글 보고 생각났어요


<bbq> 로고 보고 확신했어요



1ebec223e0dc2bae61abe9e74683766c7fe7cd88f7b45c272c8b6b000a9f23fb68c4fe6ce76a29f523b854483c84fea4


Satan Zombie Illuminati Samsung Demons can make the mark of the beast 666 left by the second beast in Revelation 13 by flipping it upside down or turning it sideways without using 6. 

The alphabet <abdegpq> can also be made with 6.

사탄 좀비 일루미나티 삼성 악마들은 요한계시록 13장에 나오는 두 번째 짐승이 남긴 짐승 666의 표를 6을 사용하지 않고 거꾸로 뒤집거나 옆으로 돌려서 만들 수 있습니다.


알파벳 <abdegpq>도 6을 사용하여 만들 수 있습니다.



In the photo of the people who died in the Itaewon terrorist attack, people are covered with yellow blankets with a picture of a bee drawn on them, so the "bee" represents 666.

이태원 테러로 사망한 사람들의 사진에서 사람들은 벌 그림이 그려진 노란색 담요를 덮고 있는데, 여기서 '벌'은 숫자 666을 상징합니다.




In Korea, you have to take off your shoes to enter a room.


It is said that human sacrifice includes taking off your shoes and socks as a sign of allegiance to Satan.


The Itaewon terrorist victims also covered their bodies with 666 blankets.


It is said that demons take off their shoes and bow before corpses as a sign of allegiance to Satan.

한국에서는 방에 들어가려면 신발을 벗어야 합니다.


인신공양에는 사탄에게 충성을 맹세하는 표시로 신발과 양말을 벗는 것이 포함된다고 합니다.


이태원 테러 희생자들은 666장의 담요로 몸을 가렸습니다.


악마들이 사탄에게 충성을 맹세하는 표시로 시체 앞에서 신발을 벗고 절을 한다고 합니다.







The second trial of Lee Jae-myung, the leader of the Democratic Party of Korea, begins at 2 p.m. = 2+2=4

The devil, who symbolizes the second beast that gives the mark of the 666 beast in the Book of Revelation,

Lee Jae-myung, the leader of the Democratic Party of Korea, Lee Jae-myung

더불어민주당 이재명 대표 2차 재판 오후 2시 시작 = 2+2=4 요한계시록에 666짐승의 표를 주는 두 번째 짐승을 상징하는 마귀, 더불어민주당 이재명 대표, 이재명





Samsung Electronics Chairman Devil Cockroach Lee Jae-yong and Zombie Cockroach Democratic Party of Korea Leader Lee Jae-myung Meeting Date March 20, 2025 = 2+2+5+3+2=14=1+4=5

삼성전자 회장 악마바퀴벌레 이재용과 좀비바퀴벌레 더불어민주당 대표 이재명 회동날짜 2025년 3월 20일 = 2+2+5+3+2=14=1+4=5








Satan Zombie Cockroach Chinese Communist Party Flag has 4 small stars and 1 large star Satan Lucifer Evil Spirit Symbol

사탄 좀비 바퀴벌레 중국 공산당 깃발에는 작은 별 4개와 큰 별 1개가 있습니다. 사탄 루시퍼 악령 상징










Major events in Korean numerology Liberation Day 8.15=14=1+4=5. 4.19=4+1+9=14=1+4=5.

Gwangju Incident in Jeollanam-do 5.18=5+1+8=14=1+4=5.

Yoon Seok-yeol martial law anniversary: ​​December 3, 2024 = 14 = 5.

The day the impeachment bill passed the National Assembly is the 14th.

Tani (real name Kim Jin-soo), a singer who sang the Sewol Ferry memorial song, died in a traffic accident on the morning of April 14, 2018.

한국 수비학의 주요 사건 광복절 8.15=14=1+4=5. 4.19=4+1+9=14=1+4=5.

전라남도 광주사태 5.18=5+1+8=14=1+4=5.

윤석열 계엄령 기념일: 2024년 12월 3일 = 14 = 5.

탄핵안이 국회를 통과한 날은 14일입니다.

세월호 추모가를 부른 가수 타니(본명 김진수)가

2018년 4월 14일 오전 교통사고로 사망했습니다.





<Illuminati Numerology 5> 4 elements (earth, air, water, fire) + Lucifer's light World ruled by Lucifer, total = 5 To the general public, the number 5 means death. But Satan's zombies symbolize blessing and protection. The changes in the movement of all things in the universe are based on the principle of energy, which is a basic and universal principle, and the four basic forces of nature known so far (strong nuclear force, weak nuclear force, and electromagnetic force). . . and gravity) 4 and +1 are caused by the action of only one force i.e. dark matter = satan lucifer the devil = 5 forces.

<일루미나티 수비학 5>

4원소(흙, 공기, 물, 불) + 루시퍼의 빛 루시퍼가 통치하는 세계, 합계 = 5 일반 대중에게 숫자 5는 죽음을 의미합니다. 하지만 사탄의 좀비들은 축복과 보호를 상징합니다.

우주 만물의 움직임의 변화는 기본적이고 보편적인 원리인 에너지의 원리와 지금까지 알려진 자연의 4가지 기본 힘(강핵력, 약한 핵력, 전자기력). . . 및 중력) 4와 +1은 단 하나의 힘, 즉 암흑 물질 = 사탄 루시퍼 악마 = 5개의 힘의 작용으로 인해 발생합니다.







Pentagram = Pentagram = Symbol of Baphomet..... Numerous national flags around the world... especially the star drawn in communist countries!

Pentagram = 오망성 = 바포멧의 상징..........전세계의 수 많은 국기들...특히 공산국가에 그려진 별!







Venus symbolizes Satan Lucifer

islamic flags

금성은 사탄 루시퍼를 상징합니다. 이슬람 깃발


From a geocentric perspective, there is a noticeable rhythm to the movement of Venus. Eight years later Venus, the Sun, Earth and the stars are again in the same relative positions. Earth orbits the Sun 8 times and Venus orbits the Sun 13 times and traces a pretty curve. This curve is called the pentagram of Venus. That's because Venus has five 'lobes' that make its closest approach to Earth.

지구 중심의 관점에서 금성의 움직임에는 눈에 띄는 리듬이 있습니다. 8 년 후 금성, 태양, 지구 및 별들은 다시 같은 상대 위치에 있습니다. 지구가 태양을 8 번 돌고 금성이 태양을 13 번 돌고 예쁜 곡선을 추적합니다. 이 곡선을 금성의 오각형이라고합니다. 금성은 지구에 가장 가까운 접근을하는 5 개의 '엽'을 가지고 있기 때문입니다.


Venus traces a pentagonal orbit in the sky. So the five-pointed star, or pentagram, was also a symbol of Ishtar and Venus.

금성은 하늘에서 오각형의 궤도를 그린다. 그래서 오각형별, 즉 펜타그램은 이쉬타르이자 비너스의 상징이기도 하였다.

Rose of Venus, Forever Conscious


비너스의 탄생, 보티첼리

 

▲ 2023년 6월 8일 국장급에 불과한 주한중국대사 싱하이밍 자택으로 찾아가 머리 조아리며 인사하는 이재명 민주당 대표. 이날 이대표는 무려 15분동안 싱대사의 우리정부 외교정책 비난과 훈계를 다소곳한 자세로 경청했다. 수행한 권칠승 대변인은 황송하다는 모습으로 이를 열심히 받아적었다. 민주당은 이 광경을 30여분간 인터넷으로 생중계했다.ⓒ연합뉴스
▲ 2023년 6월 8일 국장급에 불과한 주한중국대사 싱하이밍 자택으로 찾아가 머리 조아리며 인사하는 이재명 민주당 대표. 이날 이대표는 무려 15분동안 싱대사의 우리정부 외교정책 비난과
 On June 8, 2023, Democratic Party leader Lee Jae-myung visited the home of Chinese Ambassador to Korea Xing Haiming, who was only a director-general, and bowed to him. On that day, Representative Lee criticized Ambassador Xing’s foreign policy of our government for 15 minutes.








https://youtu.be/qWwOrUjFOFY


roseofvenus-1799-book-by-james-fergeson


venus-path-earth-venus

The path of Venus (the morning star, the bringer of the light) traced from the Earth’s viewpoint

the-five-pointed-star-of-venus-in-the-rose-window-at-eglise-saint-remi-chapel-in-troyes-france

The five-pointed star of Venus in the Rose Window at Eglise Saint Remi Chapel in Troyes, France.

https://mydevotionstodea.wordpress.com/2016/12/04/evening-star-venus-the-great-mother/







The Pentagon (미국방성 펜타곤 건물)


The layout of Washington D.C. (미국수도 와싱턴 배치도속의 오망성)


http://snippits-and-slappits.blogspot.com/2010/03/manly-p.html






Who is Baphomet?


바포멧과 오망성





와싱톤 D.C의 사탄적 오컬트(Occult) 심볼

(Satanic Occult Symbols in Washington.D.C)

 번역 http://blog.daum.net/hitto

 

 I know your tribulation and your poverty, but you are rich, and I know the slander of those who say they are Jews, but they are not, but are a synagogue of Satan. (Revelation 2:9)


내가 네 환난과 궁핍을 알거니와 실상은 네가 부요한 자니라 자칭 유대인이라 하는 자들의비방도 알거니와 실상은 유대인이 아니요 사탄의 회당이라.(요한 계시록 2장 9절)



Above) The U.S. Department of Defense (pentagon) is the center of a huge occult (magic and mysticism) symbol - the pentagram (five-pointed star).


The interior of the Pentagon completely matches the Pentagram.

 

 

위)미 국방성(pentagon)은 거대한 오컬트(마법신비주의) 심볼-펜타그램(오각형별)의 센터로서

펜타곤내는 완전히 펜타그램과 일치합니다.

 

Above) The obelisk is a symbol of the penis and is related to the Egyptian sun god Osiris.

The four sides of the Washington Monument are aligned in the cardinal directions of north, south, east and west.

Each side of the monument's ground is 55.5 feet long and measures 666 inches.

The height of the obelisk above is 555.5 feet (6,666 inches).

 Above) The obelisk is a symbol of the penis and is related to the Egyptian sun god Osiris.


The four sides of the Washington Monument are aligned in the cardinal directions of north, south, east and west.


Each side of the monument's ground is 55.5 feet long and measures 666 inches.


The height of the obelisk above is 555.5 feet (6,666 inches).






위)오벨리스크는 음경(남근)의 상징으로 이집트 태양신 오시리스(osiris)와 관계있습니다.

와싱턴 기념탑 4면은 동서남북 기본방향으로 정열이 되어 있습니다.

기념탑 지면의 각 면은 55.5피트 길이로 666인치입니다.

위 오벨리스크의 높이는 555.5피트로 6,666인치입니다)


Above) A mall in Washington DC is arranged so that the gardens and streets form the shape of an owl.


The owl symbolizes Lilith, the goddess of mystery.


George Washington (33rd degree Freemason) chose Pierre Charles L Enfant from France.


We entrust you with the urban design of Washington DC.

 

 

위)워싱턴 디씨의 몰(mall)은 정원들과 거리들이 부엉이의 형상을 이루도록 배치 되었습니다.

부엉이는 신비의 여신인 릴리쓰(Lilith)를 상징합니다.

조지워싱턴(33도 프리메이슨)은 프랑스 출신 피에르 찰스 랑팡(Pierre Charles L Enfant)을 선택,

와싱턴 디시의 도시 설계를 맡깁니다.





The city boundaries were established by George Washington in 1971, measuring 10 miles on each side and centered on the Washington Monument, its original location. The east-west diagonal line of the square crosses the Capital Building, and the north-south diagonal line crosses the White House. The length of the east-west and north-south diagonals is 10 miles times the square root of 2, or 14,142 miles.


This distance, when converted to ancient Egyptian royal cubits, is 43,455, which is the same number as the ratio of the Great Pyramid to the area of ​​the Earth.

 

 

도시의 경계들은 1971년 조지 와싱턴에 의해 세워졌는데 각 면은 10마일이고 본래 제기된 위치인 와싱턴 기념탑을 중심에 두도록 되어 있습니다. 사각형의 동서 대각선은 수도청사건물을 가로지르고, 남-북 대각선은 백악관을 가로지르고 있습니다. 동-서 와 남-북 대각선의 길이는 10마일 곱하기 2의 제곱근, 또는 14,142마일 입니다.

이 거리는 고대 이집트 로얄큐빗으로 환산하면 43,455로서, 거대 피라미드와 지구 넓이와의 비율과 같은 수치입니다.

*The height of the Great Pyramid is 481.13 feet, divided by 5280 = 0.0911231 miles.


*Earth's radius is 3,960 divided by 0.0911231 = 43,457.


*The circumference of the Great Pyramid is 3,023 feet, divided by 5,280 = 0.5725 miles.


*The circumference of the Earth is 24,880 miles, divided by 0.5725 = 43,458


*(Earth's radius) 3,960 miles / 14,142 miles = 280 (cubit height number of the Great Pyramid)


*24,880 (circumference of the Earth) / 14,142 miles = 1,760 (number of cubits around the Great Pyramid)


 


You will get the same result if you change the Earth's radius and circumference to qubits.



 

*거대 피라미드의 높이는 481.13피트로 5280으로 나누면 = 0.0911231 마일.

*지구의 반지름은 3,960으로 0.0911231 로 나누면 = 43,457.

*거대 피라미드의 둘레는 3,023피트 로 5,280으로 나누면 =0.5725 마일

*지구의 원주는 24,880마일 로 0.5725로 나누면 = 43,458

*(지구의 반지름)3,960마일 / 14,142마일 = 280(거대 피라미드의 큐빗높이 숫자)

*24,880(지구의 원주) / 14,142 마일 = 1,760 (거대 피라미드의 큐빗 둘레 숫자)

 

지구의 반지름과 둘레를 큐빗으로 바꿔도 같은 결과가 나옵니다.





 Above) The symbol indicated by the red arrow above is where the executive branch of the U.S. government is located.


If you are a Google Earth user, you can check it using satellite images.


 




 


As you can see above, the White House is at the vertex of an inverted pentagon.


This symbol is incomplete in only two pieces, as indicated by the yellow lines.

 

 위) 빨간 화살표로 위에 가르키는 심볼은 미정부의 행정부가 위치한 곳으로

구글어쓰 유저라면 위성사진으로 확인할수가 있습니다.

 

 

위에서 보시다시피 백악관은 뒤집어진 오각형의 꼭짓점에 있습니다.

이 심볼은 노란색 선에서 가리키듯 두 조각에서만 불완전 합니다. 


Above) The hexagon is almost complete. Except for one part of the yellow line to the northwest!!


 




Above) If you draw a pentagon and a hexagon together, you see three sides of the cross.


The symbol, which ends at the ground in front of the White House, perfectly represents the symmetry of the Knights Templar Cross.


 




Above) The Washington Memorial Obelisk (down arrow) is known to be located directly south of the White House.


That's not true. As you can see above, the obelisk is actually located 13 blocks north of the White House.


It is located due south of the Masonic Temple (up arrow).

 

위) 육각형은 거의 완전합니다. 북서쪽의 노란색선의 한부분만 제외하고!!




 

위) 여러분이 오각형과 육각형을 같이 그리면 십자가의 세면을 보게 됩니다.

백악관 앞에 위치한 땅에서 끝나는 심볼은 완벽하게  템플기사단 십자가 대칭을 나타냅니다.





 

위) 와싱턴 기념 오벨리스크(아래쪽 화살표)는 백악관으로부터 정남쪽에 위치한다고 알려졌지만

사실이 아닙니다. 위에서 보시다시피 , 실은 오벨리스크는 백악관의 북쪽13블럭에 있는

프리메이슨 사원(위쪽화살표)에 정남쪽에 위치하고 있습니다.






Above) The headquarters temple of the Supreme Council of Freemasons in Scotland is one of the Seven Wonders of the World.


It was modeled after the Mausoleum of Halicarnassus.


 




As mentioned above)


The obelisk is a symbol of the penis and is related to the Egyptian sun god Osiris.


The four sides of the Washington Monument are aligned in the cardinal directions of north, south, east and west.


Each side of the monument's surface is 55.5 feet long and 666 inches long.


The height of the obelisk is 555.5 feet or 6,666 inches.


The obelisk symbolizes the male genitals and was revered in all pagan cultures.


 

위) 프리메이슨 스코틀랜드 의식의 최고회의 본부사원은 세게 7대 불가사의 중에 하나인

할리카르나소스(halicarnassus)의 모솔레움 영묘를 본떠 만든 것입니다.




 

위) 위에서 언급한대로

오벨리스크는 음경(남근)의 상징으로 이집트 태양신 오시리스(osiris)와 관계있고

와싱턴 기념탑 4면은 동서남북 기본방향으로 정열이 되어 있고

기념탑 지면의 각 면은 55.5피트 길이로 666인치이며

오벨리스크의 높이는 555.5피트로 6,666인치이고,

오벨리스크는 남성의 성기를 상징하며 모든 이교문화에서 숭배가 되었던 것입니다.






이것은 남성의 근본적인 힘의 근원을 상징합니다.

사탄주의와 오컬트는 여기에 성적도착,어린아이 성폭행,그리고 인간희생제사를 함축해 놓은 것입니다.

이들 그룹의 대부분의 숭배자들은 그러한 주장을 부인하지만,

몇몇Aleister Crowley.같은 양성애자들이 공개적으로 그것을 고백했습니다.

이러한 부도덕한 오컬트의 영향들은 락뮤직, 페미니즘,

심지어 왈트 디즈니의 영화 나니아 연대기에서도 기승을 부리고 있습니다.




 

위) 왼쪽이 백악관 그리고 오른쪽이 수도청사 건물 




 

위) 직각자와 콤파스 심볼이 백악관으로 부터 수도청사 건물에 뻗쳐있는 사진 




 

위) 수도청사건물 동쪽에 완전한 육각형이 놓여있다.




 

위) 위에서 넓게 보면 수도청사건물은 부엉이 형상을 닮은 모양을 하고 있다.

부엉이는 이교도의 신을 상징하는 것이다. 야행성 새는 마법과 형이상학을 상징하는데

이는 흑마술은 진리의 빛(낮)에서는 발휘될수가 없고 오직 무지(어둠,밤)에

둘러싸여서만 힘을 발휘할수있기때문입니다.

부엉이는 영리하다고 여겨지는데 왜냐하면 그 생물은 무지와 물질의 어둠을 뚫고서도 볼수가 있기

때문이고 따라서 아테나 여신과 보헤미안 그로브에서 밤에 이루어지는 화장의식을 통한 아테나 여신숭배와

관련이 있는 것입니다.

와싱턴 디씨는 적어도 1,000여개의 12궁도와 천문학적 심볼들이 있고

확실하게 오컬트 신비주의와 점성술 상징들로 오염이 되어 있습니다.




 

위) 수도청사 건물의 꼭대기에 서있는 자유의 여신상은 , 여신 이시스 (Isis)입니다. 



 


위) 수도청사 건물을 입구를 지키고 있는 것은 니므롯(바알)으로 로마의 신인 마르스와 유사합니다.

이집트인들은 오시리스로 불럿습니다.

아래의 그림들에서 볼수 있듯이 그리스 파르테논신전과 로마 파르테논 신전의 입구와 동일 합니다. 

 

 


 


 



 

백악관을 포함해 콜롬비아 지구내 몇몇 중요한 건물들에서

고대의 디자인들을 볼수가 있습니다.

 

 

 

 


 


 

대법원 건물의 중앙부는 세계 7대 불가사의 중에 하나인

아르테미스 신전을 본따 만든 것입니다.

 

 

 

 

-------------------------------------------------------------------------------------------


 

위) 조지 와싱턴 프리메이슨 기념비는 또다른 고대 불가사의인 알렉산드리아의 파로스(Paros of Alexandria)를

본떠서 만든것으로, 와싱턴 디씨의 경계선 대각선 안의 버지니아 알렉산드리아 포토맥을 가로질러 놓여

있습니다.

 



 

위) 스미쏘니언 미국역사 박물관의 위의 와싱턴 상은 세계 7대 불가사의 중에 하나인 올림피아 제우스상을 본따

만든 것입니다.박물관은 동서남북 기본방향에 위치하며, 이 상은 동쪽을 향하는 주요층의 서쪽끝에 위치하고

있습니다. 이 와싱턴 상과 제우스와 바포메트(Baphomet)상(아래 그림)을 비교해 보시기 바랍니다.

어떤 유사점이 발견되지 않습니까?

 


 

-----------------------------------------------------------------------------------

 



미국 달라속의 사탄.

 

그림의 눈은 루시퍼를 상징하는 것으로 자신을 광명의 천사로 가장하는 어둠의 왕자입니다(고린도후서11:3)

 

""역사가이자 저술가인 랄프 에퍼슨(Ralph Epperson)은 국새(Great Seal)의 역사를 연구하는데

많은 해를 보냇는데요, 그는 위 두 원들을 디자인한 사람들은 미국을 소위 ""비밀의 운명-A Secret Destiny-에 위임했다는걸 발견 했습니다. 이 미래 "운명'이라는것은 아주 기분나쁜것으로 사람들이 그것을 바꾸게 될까봐 상징속에 진실을 은폐할수 밖에 없었다고 합니다.

(1990,아리조나 투싼,PUBLIUS PRESS 출판사.랄프 에퍼슨 "뉴 월드 오더")""

 

피라미드의 맨위 갓돌은 그가 올때 피라미드를 이루게 되는 적그리스도를 상징하는 것입니다.

짐승의 체계 ,다른말로 뉴월드오더는 준비중에 있으며 아래에서 이들 오컬트 그룹의 권력체계에 대한 정보를

얻을 수 있습니다.

 


 

위) 피라미드 맨꼭대기의 특별 위치는 루시퍼적 이념,

즉 하나님없는 전제경찰국가(Totalitarian Godless Police State)에 전적으로 위임하는 자들입니다.

 


 

이것들은 아주 실제 집단입니다.

우리는 데살로니가후서 2장 10절에서 이러한 세계의 대중들이 하나님의 진리의 말씀을 사랑하지 않기 때문에 적그리스도가 오게 될때 속게 될것이란걸 읽을수 있습니다. 

 "불의의 모든 속임으로 멸망하는 자들에게 있으리니 이는 그들이 진리의사랑을 받지 아니하여

  구원함을 받지 못함이라"""

 

-------------------------------------------------------------------------------------------------

 

국제적인 음모

 

고린도후서 4장4절에서 선포한 것처럼 사탄은 이세상의 신인 것입니다.

우리는 오늘날 인터넷상에서 오컬트를 드러내는 수많은 기사들을 봅니다만, 하나님의 말씀과

연계된 것은 충분치가 않습니다.

집단들, 많은 사실들은 당신이 하나님의 말씀을 그것에 비추기 까지는 결코 뜻이 통하지 않을 것입니다.

하나님의 말씀이 잃어버린 열쇠입니다.

사탄은 이 죄악된 세상의 신입니다, 그리고 그는 오컬트 신비주의 조직들,프리메이슨 스컬앤본즈,

보헤미안 그로브 같은 것들을 통해 그의 종들을 조종하고 있습니다.

일루미나티라는 용어는 피라미드의 구조에서 가장 높고 가장 악한 사람들을 가리킵니다.

소수의 사람들이 공산주의는 단지 뉴월드오더의 가면일 뿐이라는걸 깨다고 있을 뿐입니다.

 

공산주의의 이면의 숨겨진 비밀은 월가의 은행가들이 그것을 만드는데 도구였다는 것입니다.

 PAWNS IN THE GAME-by William Guy Carr (1958) 라는 책이 있습니다.

만일 여러분들이 일루미나티에 대해 자세하게 알고 그들의 음흉한 세계장악계획을 알고자 한다면

이 책을 읽으시길 바랍니다.

PAWNS IN THE GAME-by William Guy Carr (1958)라는 책은 어떻게 지난 250년간 주요 전쟁이 고의로

일으켜지고 재정적 지원을 받고 ,사채업자들에게 이득을 가져다 주게 되었는지 밝혀 줍니다.

놀랍게 들리겠지만 이책은 미국을 탄생하게한 미국혁명도 포함하고 있습니다.

페이지 49-58쪽에서 저자인 윌리엄 가이 카 는 어떻게 미국혁명이 영국과 프랑스혁명등을 음모한

동일한 국제 그룹들에 의해서 계획이 되었고 모의되었는지, 그리고 어떻게 국제 금융가들이 미국경제에

대한 지배권을 쥐게 되었는지를 말합니다.

여러분들은 결코 학교 수업시간에 들을수 없는 것들입니다.

 

"""사람들은 ' 공산주의는 결코 여기서는 혁명을 일으키지 않을 것입니다' 라는 스페인에서와 똑같이

    지속적으로 외치는 사람들의 말을 듣습니다. 그들은 그들에게 잘못된 안보를 줄수있는 사람들의 말을

    듣습니다. 시민들 대부분은 위험이 두려울때 담요아래 머리를 숨긴 어린아이와 같습니다.

    반드시 기억해야 될것은 이불을 머리위로 올리는 것은 결코 한 사람을 살인과 강간 또는 폭탄투척으로부터

    구해낼수 없다는 것입니다.(PAWNS IN THE GAME, 페이지 128, by William Guy Carr, 1958)."""

 

저는 오늘날의 미국인들을 이렇게 잘묘사할수 밖에 없습니다.

그들은 잘못된 안보감을 주는 사람들의 말만 듣고 있습니다!

그들은 그들의 머리를 담요아래에 숨기고 있습니다. 하원의원인 론 폴(Ron Paul)의 It Can't Happen Here 를 읽어 보십시오.

이러한 PAWNS IN THE GAME-by William Guy Carr (1958) 책에서의 인용은 여러분들에게

역사는 반복한다 또는 다른말로 사람들은 결코 배우지 않는다는 명백한 증거일 것입니다.

 

다음 인용문은 9장의 국제적 음모에 관련된 소개입니다.-PAWNS IN THE GAME-by William Guy Carr

 

 

""극소수의 사람들만이 루시퍼가 순수한 영이며 불멸이므로

그가 가장 밝고 뛰어난 하늘의 주인이라는 주장에 감사하는 것 같다.

성경은 하늘의 3분의 1에 해당하는 가장 뛰어난 천사들을 하나님으로 부터 변절시키는 그의 능력과

그에게 소속시키는 능력을 말하고 있는데 이는 하나님의 우주지배의 계획은 약하고 비현실적이기

때문이며,  열등한 존재는 알고 사랑하기 위해 가르침을 받을수 있고 그의 무한 완벽에 대한 존경심

으로 부터 그를 자발적으로 섬기기 원한다는 전제에 근거하기 때문이라고 한다.

루시퍼적 이념은 힘은 곧 권리이다 라고 말합니다.

대중들은 그들을 위한 최선이 무엇인지를 모르기 때문에 증명된 우월한 지능의 존재들은 열등한

존재들에 대한 통치권을 가진다고 주장한다.

루시퍼의 이데올로기는 오늘날 소위 전제주의(totalitarianism)라고 우리가 부르는 것이다.

 

구약성경은 단지 사탄이 어떻게 세상의 왕자가 되었는지와,  

어떻게 우리의 처음 부모를 하나님으로 부터 변절시키게 했는지를 보여주는 역사인 것이다.

그것은 어떻게 사탄의 회당이 이 지구상에 세워지게 되었는지와 관련이 있고

그 이후로 어떻게 그것이 하나님의 우주 지배의 계획을 막기 위해 이땅에 세워져 일해왔는지를 말한다.

그리스도는 음모가 그 단계에 접어 들었을때 사탄이 가장 높은 곳에서 지배하고 있는 지구에 그자신의

말씀을 사용하기 위해서 왔다.

그는 사탄의 회당을 드러냈으며(계 2:9 , 3:9) ,그것에 속한 자들을 사탄의 아들들로 비난했고

그는 그를 거짓의 아비로 (요 8:44), 속임수의 왕자(고린도후서11:14)로 그를 바로 잡았다.

그는  사탄의 회당을 구성하는 자들이 자신들을 유대인들로 부르는 자들이며 실상은

그렇지 않고 거짓이라는 언급에서 특별하다(계시록 2:9 ,3:9).

그는 환전꾼(은행가들),서기관들 바리새인들을 그시대의 일루미나티로 규정했다.""

 

 


 

 


 
예레미야 11:9-10
""여호와께서 또 내게 이르시되 유다인과 예루살렘 주민 중에 반역(Conspiracy)이 있도다

그들이 내 말 듣기를 거절한 자기들의 선조의 죄악으로 돌아가서 다른 신들을 따라 섬겼은즉 이스라엘 집과 유다 집이 내가 그들의 조상들과 맺은 언약을 깨뜨렸도다."""



























 

숫자에 대한 이들의 체계적인 믿음을 정리한 것을 수비학(Nurmerology)이라고 하는데, 이 수비학의 기초를

 놓은 사람이 바로 그 유명한 ‘피타고라스’이다.

 

수비학의 기초를 놓은 것으로 알려진 피타고라스

 

수비학에서 저들이 의미를 두는 숫자들은 ‘소수들’(素數, prime numbers : 1과 자기 자신만으로

 나누어떨어지는 1보다 큰 양의 정수)이다. 

 

모든 소수들을 중요시 여기지만 그 가운데서도 2, 3, 5, 7, 11, 13이라는 숫자에는 보다 특별한 

의미를 부여하고 있다. 그 부분에 대해 잠시 살펴보자.

 

2는 분리를 의미하는 숫자이다. 신과의 완전한 분리를 나타낼 때 2를 사용한다.  

3은 왕권을 의미하는 숫자이다. 사탄의 삼위일체인 니므롯, 세미라미스, 담무스 혹은 오시스, 이시스,

 호루스를 의미한다.

 

이 셋이 합쳐져서 사탄의 왕국(세계정부)을 만들어낸다는 것이다.

 

5는 죽음의 숫자 혹은 일루미나티들을 죽음에서 보호하는 숫자라고 알려져 있다.

 

6은 소수는 아니지만 소수인 3의 배수로서 사람의 숫자이다.

 

7은 완전 혹은 신의 숫자로 알려져 있다.

 

9는 3이 3번 합쳐진 숫자로 완성을 의미한다.

 

11은 파괴와 심판 그리고 인간의 죽음을 의미하는 숫자이다. 라틴어로 악마를 의미하는 단어가 LVX인데 이것이 11이라는 숫자와 연관되어 있다.

(L=50, V=5, X=10 50+5+10=65=6+5=11)

 

13은 행운과 불행 모두를 의미하는 숫자로 알려져 있다.

 

이렇듯 주술적인 의미를 가지고 있다고 믿는 2,3,5,7,11,13의 숫자들과 이것들이 합쳐진 혹은 배가된 숫자들을 조합하여 저들이 중요시 여기는 사건을 택일할 때 그 기준으로 삼고 있다는 것이다.

 

그럼 이 숫자들 가운데 특별히 11과 연관된 일루미나티의 음모를 살펴보자.

 

파괴와 심판, 그리고 인간의 죽음을 의미하는 숫자 11은, 12개의 별자리(Zodiac)들 가운데 11번째 별자리인 물병자리(Aquarius)를 의미하는 숫자이기도 하다.

 

물 병자리는 New Age를 의미하는 별자리로 알려져 있다. 정리하면 일루미나티에게 있어 숫자 11은 구시대(Old World Order)를 끝내고(파괴하고), 새로운 시대(New World Order)를 열어 가는데 반드시 고려해야 할 가장 중요한 숫자인 것이다.

 

 

수비학과 깊은 연관이 있는 별자리(Zodiac) 11번째 별자리가 바로

New Age로 알려진 물병자리이다.

 

New World Order와 연관된 숫자 11은 먼저 New World Order로 가기 위한 준비 작업이었다고 알려진 9.11사태에서 집중적으로 드러나고 있다.

 

9.11과 Numerology

1. 911사태가 일어난 날이 11일이다.

2. 911사태를 의미하는 세 숫자를 더하면 (9+1+1) 11이 된다.

3. 쌍둥이 빌딩이 숫자 11을 연상시킨다.

4. 쌍둥이 빌딩에 처음 부딪친 비행기가 American Airlines Flight #11이었다.

5. 쌍둥이 빌딩에 두 번째 부딪친 비행기가 United Airlines Flight #77 [11 x 7]이었다.

6. 쌍둥이 빌딩의 높이가 110층(11*10)이었다.

7. 9월 11일은 일년 365일 가운데 254(2+5+4=11)일 째 되는 날이며,

     그 후로 남은 날은 111일이다.

8. 공격이 있었던 뉴욕주(New York State)는 미국 독립에 참가했던

     13개의 주 가운데 11번째로 참가한 주이다.

9. 9.11 테러가 있기 정확히 11년 전인 1990년 9월 11일은

    당시 미국의 대통령이었던 아버지 부시가 미국의 국회 의사당에서

    세계의 지도자로서는 처음으로 New World Order의 구상을 밝힌 날이기도 하다.

 

2012와 Numerology

2012년은 앞서 소개한 911사태가 발발한지 또 다시 11년째 되는 해이다. 911사태로부터 시작된 New World Order의 준비 작업이 그 결실을 보는 해(New World Order 실현의 해)인 것이다. 

 

이처럼 중요한 해이기 때문에 2012년 'Numerology'에 근거한 일루미나티의 음모들이 계획되고 있을 것이라 보는 것이다.

 

먼저, 마야인들이 인류 종말의 날로 예언했다고 해서 유명해진 2012년 12월 21일을 살펴보자. 이 날은 먼저 2001년 911사태가 발생한지 정확히 11년 101(1+0+1=11)일째 되는 날이다.

 

여기에도 11이라는 숫자가 두 번 등장한다. 그리고 2012년 12월 21일라는 날짜에서 개개의 숫자들을 모두 합치면 (2+0+1+2+1+2+2+1) 11이라는 숫자가 나온다.

 

2012년 12월 21일 11시 11분은 11이라는 숫자가 세 번 합쳐지는 시간이다. 이 시간을 New World Order(New Age)의 시발점(D-day)으로 보는 것이다.

 

911사태에서 알 수 있듯이 New World Order는 구시대의 질서(Old World Order)를 파괴함으로 찾아오는 것이다.

 

저들이 만일 2012년 12월 21일을 New World Order의 출발점으로 생각한다면 이를 실현하기 위해 현재의 세계질서를 파괴시키는 여러가지 일들을 꾸밀 것이다.  

 

금융위기를 통한 '경제질서의 붕괴', 각종 재난과 테러를 통한 '사회질서의 붕괴', 3차 대전과 같은 전쟁을 통한 '정치질서의 붕괴'가 2012년 한 해 동안 휘몰아치지 않을까 염려스러운 것이다.

 

- 예레미야 -

 

 

* 참고 자료*

http://www.cuttingedge.org/NEWS/n1756.cfm

http://parabook.wordpress.com/2010/02/04/numerology-and-the-illuminati/

http://adventofdeception.com/occult-numerology-2012/



출처 : 이 세대가 가기 전에 / 예레미야






 




성경의 첫번째 책

창세기 11장에 ...

님롯의 바벨탑의 건설과  심판이 나오며


성경의 11번째  책  ..

11장 11절에

솔로몬의 심판이 나옵니다


 


성경의 마지막 책

9:11에서

구렁 즉 지옥의 천사요 그들의 왕인

히브리어로 아바돈이며....헬라어로 아폴루온이 등장합니다.

 




 




신비의 숫자 11과 세계무역센터 폭파

 

Terry Watkins / 권승천 譯 (cheon1107@hanmail.net )

 

2001년 9월 11일 미국 역사상 최악의 비극이 발생했다.

미 항공 여객기 11편기가 세계 쌍둥이 타워와 충돌 폭파되었다. 당국자들은 미친 듯이 11편기에 무슨 일이 있었는지를 찾고 있는 동안, 불과 55분 뒤, 마치 미사일과 같은 속도로 92명의 무죄한 승객을 태운 미 항공 여객기 77편기가 두 번째 쌍둥이 빌딩과 충돌 폭파되었다. 여객기가 끔찍한 미사일로 변해 영문도 모르고 있는 사람들로 가득한 무역 센터 건물에서 폭파되는 장면을 TV로 지켜본 사람들의 마음은 한결같을 수가 없었다.

우리의 조국이 산산이 부서졌다.
우리의 생명들이 파편처럼 날아갔다.
많은 사랑하는 사람들과 꿈들이 사라져 버렸다.     

그처럼 끔찍스럽고 기절 초풍할 비극에서, 있을 수 도 있는 어떤 숨겨진 의미를 찾으려는 시도는 아주 당연한 것이다. 그와 같은 비극에는 어떤 숨겨진 이유가 있는 것일까? 하나님께서 미국인들에게 어떤 주의를 주시는 것일까? 왜 하나님께서는 그처럼 사악한 일이 벌어지도록 허락하셨을까? 어떻게 그토록 파괴적이고, 그토록 사악하고, 그토록 몰지각한 일이 일어 날수 있으며, 하나님께서는 하실 말씀이 없으시단 말인가?

 

  

  

  

많은 사람들이 9월 11일의 세계 무역 센타 폭파와 관련하여 그 재난적인 사건에서 빈번하게 나타나는 11이라는 숫자에 관해 내게 메일을 보내왔다.

공격 일 :  11
공격 날짜 : 9월 11일 : 9/11 = 9+1+1=11
응급구조 전화번호 911 : 9+1+1=11
9월 11일은 1년 중 254번째 날이다. : 2+5+4=11
9월 11일 이후는 연말까지는 111일이 남는다.
119는 이란과 이라크의 지역 번호이다 : 1+1+9=11
두 개의 빌딩중 한 빌딩에 부딪힌 첫 번째 비행기는 11편기 였다.
뉴욕주는 11 번 째 주이다.
뉴욕시(New York City)는 11글자다.
아프가니스탄(Afghanistan)은 11글자다.
11편기는 92명의 탑승객이 있었다. : 9+2=11
77편기는 65명의 탑승객이 있었다. : 6+5=11
쌍둥이 빌딩은 11처럼 보인다.
쌍둥이 빌딩은 110층이다.

 

이처럼 11이라는 숫자가 반복적으로 나타나는 것에는 어떤 깊은 의미가 있는 걸까?

아니면 단지 기묘한 우연의 일치일까?

진지한 성경 학도라면 누구라도 알고 있는 것처럼, 하나님께서는 어떤 숫자들에 대하여 특별한 의미를 부여하신다. 성경과 수에 관해 씌어진 책들이 몇 권 있다.  Ed. F. Vallowe의 성경의 수학(Biblical Mathematics) , 피터 럭크만 박사의 성경의 숫자학(Bible numerics), E. W. Bullinger의 성경 속의 숫자(Number in Scripture), Robert D. Johnston의 성경속의 수들(Numbers in Bible), 그리고 Dr. Paul Heaton의 13이라는 수의 공포(Triskaidekaphodia-The Fear of The Number 13)들이 그것이다.

 

 Bullinger는 자신의 뛰어난 책인 성경 속의 숫자(Number in Scripture)에서 다음과 같이 적고 있다.




 " 우리가 반드시 대답해야 할 질문은 숫자가 계획적으로 사용된 것인지 아니면 단지 우연히 사용된 것 인지의 여부이다. 분명히 하나님께서 숫자를 사용하신다면, 그 숫자는 무한한 지혜와 하나님의 영광을 보여주는 완전함을 가지고 있음에 틀림없다. 그리고 사실 그러하다. 각각의 숫자는 고유의 의미를 지닌다. ........ 숫자들과 .....그 숫자들의 비밀은 하나님의 행하심뿐만 아니라 하나님의 말씀 속에서도 중요한 위치를 차지한다. (E. W. Bullinger. Number in Scripture, pp. 20-21)"

 

Ed Vallowe는 성경의 수학(Biblical Mathematics)에서 다음과 같이 말한다.




 " 만일 성경이 주장대로 영감 받은 책이라면, 말씀뿐만 아니라 그 숫자도 또한 영감 받은 것이 아닌가? 성경의 책들 가운데 하나는 '민수기(numbers)' 라고 불리지 않는가? 성경에서 다섯 구절 중에 하나는 어떤 수를 포함하고 있다..... 성경은 처음부터 끝까지 방대한 숫자들의 체계 위에서 만들어진 책이며 이 숫자들이 마치 날줄과 씨줄처럼 서로 엮어져 하나님 말씀의 교리를 만들어 낸다. (Ed F. Vallowe, Biblical Mathematics, p. 20)"

 

숫자들 가운데 성경에서 독특한 의미를 가지고 사용되는 한가지 예는 666이 아닐까? 요한 계시록 13:18에서 그 수는 짐승의 표로 언급된다.

지혜 여기에 있으니 지각이 있는 자는 그 짐승의 수를 세어 볼지니라. 그 까닭은 그것이 어떤 사람의 수이기 때문이니 그의 수는 육백 육십 육이니라(계시록13:18).

성경은 명백하게 6이라는 수를 사람과 연관시키고 있다. 계시록 13:18은 분명히 이렇게 씌어있다. 

 " ......그것은 어떤 사람의 수(the number of a man)이니....."  

이 숫자 6과 사람과의 상관 관계는 성경 전체에서 발견된다.  

사람은 6일째에 창조되었다.  

     하 나님께서 이르시되, 우리가 우리의 형상으로 우리의 모양에 따라 사람을 만들고 그들로 하여금 바다의 물고기와 공중의 날짐승과 가축과 온 땅과 땅에서 기는 모든 것들을 지배하게 하자 하시고 하나님께서 자신의 형상으로 사람을 창조하시되 하나님의 형상으로 사람을 창조하시고 그들을 남성과 여성으로 창조하시니라......하나님께서 자신이 만든 모든 것을 보시니, 보라, 매우 좋았더라. 그 저녁과 아침이 여섯째 날이니라.
( 창1:26, 27, 31)

사람은 한 주에 6일 동안 일해야 한다. 

     엿새 동안은 네가 수고하고 네 모든 일을 할 것이나 일곱째 날은 주 네 하나님의 안식일 인즉 그 날에는 너나 네 아들이나 네 딸이나 네 남종이나 네 여종이나 네 가축이나 네 문안에 거하는 나그네나 아무 일도 하지 말라. (출20:9, 10)

6일 동안은 인간의 날이지만 일곱째 날은 주님의 날이다.

      너 는 육 년 동안 네 밭에 씨를 뿌리며 육 년 동안 네 포도원을 가꾸어 그 열매를 거둘 것이나 칠 년째 되는 해는 그 땅에 안식하는 안식이 있게 할지니 이것은 주께 대한 안식이라. 너는 네 밭에 씨를 뿌리거나 네 포도원을 가꾸지 말며(레위기 25:3,4)

6이라는 숫자가 인간(사람)의 숫자인 이유는 무엇일까?

성경은 66권이다. 성경은 인간을 위한 하나님의 메시지이다.

사람이란 단어는 창세기 6장에서 6번 나온다. (3,5,6절,7,9절에서 2번)
사람이란 단어는 역대기 하 6장에서 6번 나온다.(5,16,22,29,30,36절)
사람이란 단어는 갈라디아서 6장에서 6번 나온다.(1,3,4,5,7,17절)

 

성경에는 하나님의 일곱 경륜(dispensation)이 있다. 이중 6번은 사람에 의해 통치되며 7번째 경륜(1000년)은 주님이 통치하신다.  

일곱 경륜은 다음과 같다.

1. 무죄 시대-창조부터 타락까지
2. 양심의 시대-타락에서 홍수까지
3. 인간 정부시대-홍수에서 아브라함이 부름을 받을 때까지
4. 약속의 시대-아브라함의 부르심부터 시내 산에서 모세 영도 아래서 시내 산에서 율법을 받기까지
5. 율법의 시대-시내 산에서 갈보리까지
6. 은혜의 시대-갈보리에서 왕국까지
7. 왕국 시대- 1000년 간의  메시아의 통치 시대 

 

여호수아서(Joshua)는 구약의 6번째 책이다.

여호수아 책은 이런 책이다.

사람 이름으로 명명되는 첫 번째 책이다.

여호수아(Joshua)의 이름은 여섯 글자이다.
사람이라는 단어가 여호수아 6장에서 6번 나온다.(2,3,9,13,22,23절)
이스라엘은 여리고를 6장에서 6번 돈다.
6일 동안 하루에 한번씩 6번 돌고, 마지막 7일째는? 7번(1000년 간의 통치)
여호수아서는 24장(4 ×6)으로 되어 있다.
사람이라는 단어가 여호수아서에서 30번(5 ×6) 나온다.  

 

로마서(Romans)는 신약의 6번째 책이다.

로마서는 이런 책이다.

로마서는 여섯 글자다: (Romans)
로마서는 그 이름 안에 사람(man)이라는 단어가 들어 있다: Romans (성경에서 man이 들어 있는 유일한 책이다.)
사람은 로마서 6장 6절에서 6번째 단어다.
사람은 로마서의 6개 구절에서 6번째 단어이다.(2:1, 2:3, 2:6, 3:28, 5:7, 6:6)
로마서는 16장으로 되어 있다. 

 

"사람의 아들(Son of MAN)"이란 말은 신약에서 84번(14 ×6) 나온다. 14라는 숫자는 구원이라는 의미를 지니는 수이다. 그리고 6은 사람을 상징하는 수이다. 예수 그리스도, 사람의 아들은 사람(MAN:6)들을 구원하기(deliver:14) 위하여 이 세상에 오셨다.

사 람의 세속적인 세상에서조차도 6이라는 숫자와 얽혀 있다. 세상은 가장 오래 된 사본이라는 것을 뒤적이며 킹 제임스 성경의 부적절함을 지적하는 일에 대하여 자랑스러워할지 모르지만, 킹제임스 성경은 그 진실성을 스스로 증거하고 있다.  

 

예를 들어, 사람이 사는 세상은 이렇다.

1분은 60초(6 ×10)다.
1시간은 60분(6 ×10)이다.
하루는 24시간(4 ×6)이다.
성경에서의 1년은 360일(60 ×6)이다.
1년은 12달(2 ×6)이다.
24개의(4 ×6) 시간대가 있다.
위도와 경도는 360도(60 ×6)이다.
1피트는 12인치(2 ×6)이다.
1야드는 36인치(6 ×6)이다.
1마일은 5280피트(880 ×6)이다.
원은(지구) 360도(60 ×6)이다.

 

다른 숫자를 가지고는 이렇게 할 수 없다. 한번 해 보라! 어떤 수든지 다른 숫자를 가지고 해 보라. 

인간의 몸에는 6개의 주요한 지체가 있다: 머리, 몸통, 두 팔과 두 다리.
보통 사람의 몸은 6쿼트의 피를 가지고 있다.
보통 사람의 몸 속의 피는 하루에 12,000마일(2000 ×6)을 이동한다.
평균 심장 박동 수는 1분에 72회(12 ×6)다.
사람 몸 속의 혈관의 길이는 60,000마일(6 ×10000)이다.
평균 폐의 무게는 600그램(100 ×6)이다.
평균 폐 용량은 6리터이다.
사람의 몸 속에는 600개(100 ×6)의 근육이 있다.
사람의 몸에는 6개의 감각이 있다.-시각, 청각, 후각, 미각, 촉각, 평형감각
사람의 몸에는 6개의 중요한 기관이 있다-골격계관, 순환기관, 신경기관, 근육기관, 소화기관, 생식기관
사람의 평균 치수는 6피트이다.
출생 시 평균 몸무게는 6파운드다.
현재 인구는? 6십억(주님이 오실 최적기다.) 

 

왜 사람이 지하 6피트의 깊이에 묻히는지 궁금한가? 당신이 사는 지역의 매장지 사무실에 전화해서 하필이면 왜 6피트인지 물어 보라. 7도 아니고 5도 아닌 왜 6피트인지! 나는 개인적으로 몇 군데의 매장지 사무실에 전화를 해서 왜 6피트인지를 물어 보았다.  그것이 "사실상의 표준"이라는 것 외에는 아무도 아는 사람이 없었다. 하지만 나는 그 이유를 알고 있다. 6 이라는 숫자는 사람의 수이기 때문이다.  

아무튼, TV 방송국이 "초인적인 힘을 가진 사람"에 대한 드라마를 제작했을 때, 뭐라고 불렀는지 아는가? "6백만 달러의 사나이"였다.  

그 이유가 궁금하지 않는가? 6은 인간에 대한 하나님의 숫자이기 때문이다

 

숫자 11은 어떠한가? 

하나님의 말씀에서 발견되는 11이라는 숫자와 관련하여 어떤 특별한 의미가 있는 걸까? 

숫자 11과 관련된 두 가지 분명한 의미가 있다. 
숫자 "11
"의 한가지 의미는 급박함, 마지막 기회, 혹은 무슨 일이 막 일어날 찰나에 있음을 나타낸다.   

이 의미는 "마지막 기회"란 의미의 열한시(eleventh hour)란 표현에서 잘 나타난다. 주 예수 그리스도께서는 마태복음 20장에서 "열한시(the eleventh hour)"란 말을 2번 말씀하셨다. 

"열한시"는 긴박함, 어떤 일이 벌어지기 전 마지막 기회를 의미한다.

      이 는 하늘의 왕국이 마치 품꾼을 고용하여 자기 포도원에 들여보내려고 아침 일찍 나간 집 주인과 같기 때문이니 그가 하루에 일 데나리온씩 주기로 품꾼들과 합의하여 그들을 자기 포도원에 들여보내고 또 세 시쯤 나가 보니 시장에서 놀고 서 있는 다른 자들이 있으므로 그들에게 이르되, 너희도 포도원으로 들어가라. 내가 너희에게 무엇이든지 정당한 것을 주리라, 하니 그들이 가고 또 그가 여섯 시와 아홉 시쯤에 나가 그와 같이 하고 또 열 한시쯤에 나가보니 놀고 서있는 다른 자들이 있으므로 그들에게 이르되, 너희는 어찌하여 온 종일 여기서 놀고 서 있느냐? 하니 그들이 이르되, 우리를 고용하는 사람이 아무도 없었음이니이다, 하매 그가 이르되, 너희도 포도원에 들어가라. 무엇이든지 정당한 것을 너희가 받으리라, 하니라. 날이 저물매 포도원 주 인이 자기 청지기에게 이르되, 품꾼들을 불러 나중 온 자로부터 시작하여 먼저 온 자까지 품삯을 주라, 하니 열 한시쯤 고용된 자들이 와서 각각 일 데나리온씩 받거늘, 먼저 온 자들이 와서 더 받을 줄 알았으나 자기들도 각각 일 데나리온씩 받으매 그들이 그것을 받은 뒤에 그 집 주인에 대하여 투덜거리며 이르되, 나중에 온 이 사람들은 한 시간만 일하였거늘 낮의 열기와 무거운 짐을 견딘 우리와 같게 대우하였나이다, 하거늘 주인이 그들 가운데 한 사람에게 대답하여 이르되, 친구여, 내가 네게 잘 못 한 것이 없노라. 네가 나와 일 데나리온으로 합의하지 아니하였느냐? (마20:1-13)

성경에서의 하루는 해가 떠서 질 때까지를 12시간으로 나누어 측정했다. 따라서 12시는 어두운 밤이었다. 그러므로 열한시란 표현은 마지막 시간, 즉 해가 지기 직전의 시간을 말한다.  

마 태복음 20장에서, 주 예수님은 마지막 기회를 뜻하는 그 유명한 "열한시(eleventh hour)"란 말을 만들어 내셨다. 그 말은 "시간이 다 되었다." "마지막 가능한 순간"이라는 경고나 급박함을 나타내는 말로서  지금까지 사용되고 있다.











 American Heritage Dictionary

  the latest possible time (가능한 마지막 기회에)

 Webster Dictionary

  the latest possible time (가능한 마지막 기회에)

 Oxford Dictionary

  at the latest possible time (가능한 마지막 기회에)

열한시에 대한 몇 가지 세상의 정의를 보자. 

숫자 11은 분명히 "마지막 기회"와 관련이 있다. 

주님은 미국과 세상에 급박한 11시의 경고를 보내고 계시는 것은 아닐까? 우리는 마감시간 전의 열한시(마지막 기회)에 서있는 걸까?

우리는 인류 역사상 열한시(마지막 순간)의 중대한 사건을 목격하고 있는 것일까?

 

어쩌면.....

성경은 분명하게 숫자 11의 또 다른 모습을 그려내고 있다.

하나님의 말씀 전체를 한치의 오차도 없이 엮고 있고 훨씬 더 명확하며.....훨씬 더 경악하게 하는 수. 

성경은 명백하게 숫자 11을 심판과 관련시키고 있다.

 

타락 이후 첫 번째 심판

인간의 타락 후 인류에게 행해진 첫 번째 심판은 카인이 자신의 동생인 아벨을 죽인 결과였다. 그 심판은 창세기 4장 11절에서 행해졌다. 

땅이 그 입을 벌려 네 손에서 네 동생의 피를 받았은즉 이제 네가 땅에서 저주를 받으리니(창세기 4: 11) 

어떤 사람은 아마도 생각하기를.....와! 하지만 잠깐만! 성경의 장과 절의 숫자는 영감 받지 않았습니다. 히브리어 원문 사본에는 장과 절이 없어요! 따라서 장과 절의 숫자가 갖는 "의미"는 무시해야 합니다. 

만일 장과 절의 숫자가 영감 받은 것이 아니라면 - 모음들과 어간(語幹: 단어와 단어 사이의 공백) 어떠한가? 히브리어 원문 본문은 모음과 어간(語幹), 소문자들이 없었다.(또한 왼쪽에서 오른쪽으로 읽는다.) 

만일 히브리어 원문 사본만이 영감 받은 것이라면 - 그렇다면 어간들과, 모음들, 그리고 소문자들을 구약에서 다 없애 버리자. 당신은 다음의 글을 읽을 수 있을까? 

SLMFDVDTHLRDSMYSHPHRDSHLLNTWNTHMK
THMTLDWNNGRNPSTRSHLDTHMBSDTHSTLLW
TRSHRSTRTHMYSLHLDTHMNTHPTHSFRGHTS
NSSFRHSNMSSKYTHGHWLKTHRGHTHVLLYFT
HSHDWFDTHWLLFRNVLFRTHRTWTHMTHYRDN
DTHYSTFFTHYCMFRTMTHPRPRSTTBLBFRMN
THPRSNCFMNNMSTHNNTSTMYHDWTHLMYCPR
NNTHVRSRLYGDNSSNDMRCYSHLLFLLWMLLT
HDYSFMYLFNDWLLDWLLNTHHSFTHLRDFRVR 

이해했습니까?

그럼 계속 나갈까요?

좋습니다.

 

두 번째 심판은 노아의 홍수였다. 

두 번째 심판은 노아 당시의 홍수였다. 그 심판은 창세기 7장 11절에서 행해졌다.  

      노아의 생애에서 육백 년 되던 해 둘째 달 곧 그 달 십칠일 바로 그 날에 큰 깊음의 샘들이 다 터지며 하늘의 창들이 열려 (창세기 7:11) 

 

세 번째 심판은 가나안에 내려졌다. 

노 아에게는 세 아들이 있었다. 셈과 함, 야벳 이다. 함은 벌거벗은 아버지를 바라보았다는 이유로 하나님께서는 함의 아들 가나안에게 심판을 내리셨다. 주의 : 하나님께서는 창세기 9:1에서 함을 축복하셨기에 그를 저주하실 수는 없었다. 

창세기 9:25는 가나안의 심판을 묘사하고 있다. 

이에 이르되, 가나안은 저주를 받을 것이요, 그 형제들에게 종들의 종이 될 것이니라, 하고 (창세기9:25)

왜 하나님께서는 함의 아들 가나안을 심판하셨을까? 함에게는 적어도 네 아들이 있었다. 구스, 미스라임, 붓, 가나안이다(창10:6). 왜 가나안이 저주를 받았을까? 정상적으로는, 저주나 축복은 장자에게 임했다. 그렇다면 왜 가나안이 저주를 받았다는 말인가? 가나안에게 열한 명의 아들이 있었기 때문이었을까? "가나안에 대한 저주"는 가나안의 열한 명의 아들들 위에 내려 졌다(창세기 10:15-18). 

 

바벨탑에 대한 심판은.....

 

성 경은 악명 높은 바벨탑에 대하여 말하고 있다. 니므롯은 바벨탑을 세워 인간의 역사 속에 단일 세계 질서(one-world-order)를 가져오려고 했다. 하나님께서는 니므롯과 그 일행들에게 언어를 혼잡케 하심으로 심판하셨다. 따라서 그들은 서로 하는 말을 알아들을 수 없었다.

니므롯의 심판은 창세기 "11"장 7절에 나온다.

 자, 우리가 내려가서 거기서 그들의  언어를 혼잡하게 하여 그들로 하여금 서로의 말을 알아듣지 못하게 하자, 하시고 (창11장 7절)


 


 

 

소돔 사람들에 대한 심판  

소 돔과 고모라의 사악함 때문에, 하나님께서는 소돔과 고모라를 멸하기 위하여 두 명의 천사를 보냈다. 두 천사가 롯의 집에 도착하자, 소돔의 남자들이 롯의 집을 에워싸고 성적 욕구를 채우기 위해 롯에게 그 사람들(천사들) 내어 줄 것을 요구했다. 그러자 두 천사들은 소돔의 남자들을 쳐서 눈이 멀게 하는 심판을 내렸다. 그 심판은 창세기 19장 "11"절에서 행해졌다.  

  큰 자든 작은 자든 집 문에 있는 남자들을 다 쳐서 눈을 멀게 하니 그들이 문을 찾느라 애를 쓰더라
(창세기 19:11절)


 이집트에 대한 심판은.....

 

B.C. 1700년에, 이스라엘 자손들은 이집트의 노예가 되었다. 그리고 하나님께서는 이스라엘을 약속의 땅으로 인도하기 위하여 모세라는 한 사람을 부르셨다. 그러나 이집트의 왕 파라오는 이스라엘을 풀어 주기를 거절했다. 이집트의 왕 파라오는 이스라엘의 자손들을 풀어 주기를 거절했기 때문에, 주님은 이집트에 대하여 "11"가지 심판들을 내리셨다. 


 

 

 

1. 피의 재앙(출7:19-21)
2. 개구리의 재앙(출8:1-7)
3. 이의 재앙(출8:16-17)
4. 파리의 재앙(출8:21-24)
5. 전염병의 재앙(출9:1-7)
6. 종기의 재앙(출9:8-110
7. 우박의 재앙(출9:22-25)
8. 메뚜기의 재앙(출10:12-15)
9. 어둠의 재앙(출10:21-23)
10. 첫 태생의 재앙(출12:29-30)
11. 이집트 군이 홍해에서 익사(출14:24-28) 

 

이스라엘에 대한 심판은....

주 하나님께서 이스라엘을 이집트의 속박에서 구원하신 후, 이스라엘은 창세기 17:8에서 아브라함에게 약속하셨던 땅으로 되돌아 가야했다. 이스라엘의 자손이 약속의 땅에 가까이 왔을 때, 민수기 13장에서, 그들은 카데스바네아(Kadeshbarnea)에서 행군을 멈추었다. 그곳에서, 주 하나님께서 그 땅을 이스라엘에게 이미 약속을 하셨음에도 그들은 약속의 땅을 정찰하기 위하여, 각 지파에서 1명씩 선발하여 12명을 보냈다. 정찰 나간 자들이 돌아왔고 선발된 12명중 "11"명은  약속의 땅에 들어가 그 땅을 소유할 수 없었다. 민수기 13:30에서, "즉시 올라가 그 땅을 차지하자"고 말한 사람은 오로지 갈렙 뿐이었다. 다른 "11"명은 민수기 13:32에 따르면, "악한 보고(evil report)"를 가져왔다.  

이스라엘 자손에게 자기들이 탐지한 땅에 대하여 나쁘게 (한글 킹제임스 성경은 "악한"으로 번역함-역자 주) 보고 하며 이르되, 우리가 두루 다니며 탐지한 땅은 그곳 거주민들을 삼키는 땅이요, 우리가 거기서 본 모든 백성들은 키가 큰 자들이며  (민수기13:32)

"11"명의 악한 보고 때문에, 이스라엘은 약속의 땅에 들어가기를 거절했다. 그래서 이스라엘은 40년 동안을 광야를 방황해야하는 "심판"이 내려졌다.  

"11"명 때문에, 이스라엘은 심판을 받았다.

하지만 이것이 전부가 아니다.  

 

신명기 1:2에서, 성경은 이스라엘이 카데스바네아(Kadeshbarnea)에 머물렀던 때를 구체적으로 말해준다. 민수기 13장에서 주님이 이스라엘에 심판을 내리셨던 곳이 아닌가? 호렙에서 "열 하루(11)"길이었다! 

모세가 요르단 이편 광야 곧 바란과 도벨과 라반과 하세롯과 디사합 사이에 있는 홍해 맞은편 광야에서 온 이스라엘에게 전한 말씀이 이러하니라. (호렙에서 가데스바네아까지는 세일 산길로 열 하루 길이었더라)
(신명기1:1-2). 

 

만일 이스라엘이 계속해서 진군을 했더라면!

만일 이스라엘이 12일을 이동했다면, 꼭 하루만 더 나아갔다면, 그들은 하나님이 정하시고 약속 하셨던 땅에 있었을 것을...

하지만 그들은 "열 하루"길에서 멈추었다.   그리고 "심판"이 이스라엘에 내렸다.

 

● 열 하루(11)길 때문에
● 11명의 악한 보고 때문에
● 길고도 고통스러운 40년 동안의 방랑이라는 심판이 이스라엘에 내려졌다.  

 

11이라는 숫자가 심판을 뜻하는 하나님의 숫자라는 것에 어떤 의심이 있는가?   

하지만 이것도 전부가 아니다. 

 

삼손에 대한 심판

1100개(11*100)의 은 때문에 삼손은 심판을 받았다. 블레셋 사람들은 들릴라에게 삼손을 팔아 넘기는 조건으로 1100개의 은을 지불했다.  

블 레셋 사람들의 영주들이 그 여인에게로 올라와 그녀에게 이르되, 삼손을 꾀어 그의 큰 힘이 어디서 나오는지 알아보고 또 어떤 방법으로 우리가 그를 이기고 결박하여 괴롭게 할 수 있는지 알아보라. 그리하면 우리가 각각 은 천 백개를 네게 주리라, 하더라 (사사기 16:5) 

 

솔로몬에 대한 심판

성경에 나오는 어떤 수들의 특정한 의미를 푸는 열쇠들 가운데 하나는 성경에 있는 책의 번호(number)와 장, 절을 선택된 숫자와 맞춰보는 것이다. 피터 럭크만 박사는 자신의 책 bible numerics에서 이 기법을 설명하고 있다. 

『어 떤 수의 의미를 발견하기 위해 일반적으로 행해지는 방법으로서, 당신이 해야 할 일은 그 책의 번호 즉  몇 번째 책인가를 알아보는 것이다. 예를 들어 11을 찾는다면, 성경에서 11번째 책을 선택한다. 11번째 책을 찾은 후, 그 책의 11장과 11절을 살펴본다.( Peter S. Ruckman, Bible Numerics, P. 33)』

한번 시험해 볼까? 

11번째 책은 열왕기 상이다. 다음 단계로 11장 11절을 읽어보자. 

주께서 솔로몬에게 이르시되, 네가 이러한 일을 행하였고 또 네가 내 언약과 내가 네게 명령한 내 법규를 지키지 아니하였으니 내가 반드시 이 왕국을 네게서 빼앗아 네 신하에게 주리라 (열왕기 상 11:11)

열왕기상 11:11은 명백하게 솔로몬에 대한 심판을 언급하고 있다. 

솔 로몬의 왕국은 당대에 지상에서 가장 크고, 가장 강력하며, 가장 부유한 왕국이었다. 오늘날의 미국도 마찬가지다. 솔로몬은 하나님의 말씀에 불순종했고, "나의 언약과 법규를 지키지 아니했기에", 하나님께서는 솔로몬으로부터 축복과 보호를 제하여 버리셨다. 미국도 그러한 것인가? 

 

이스라엘에 대한 심판

여호야김과 시드기야 두 왕만이 이스라엘을 11년 동안 통치했으며, 그리고 두 왕은 이스라엘에 끔찍한 심판을 가져왔다.

 

여호야김에 대한 심판

열왕기하 23장과 역대기하 36장에서, 여호야김의 11년 간의 왕국 통치기간 동안 심판이 내렸음을 읽게된다. 

여호야김이 통치하기 시작할 때에 나이가 이십 오 세더라. 그가 예루살렘에서 십일 년 동안 통치하니라....여호야김이 자기 조상들이 행한 모든 것에 따라 주의 눈앞에서 악한 것을 행하였더라... (열왕기하 23:36-37)

여 호야김 시대에 바빌론 왕 느부갓네살이 올라오매 여호야김이 삼 년 동안 그의 신하가 되었다가 돌이켜 그를 배반하였더니 주께서 자신의 종 대언자들을 통하여 하신 말씀과 같이 갈대아 사람들의 부대와 시리아 사람들의 부대와 모압 족속의 부대와 암몬 자손의 부대를 여호야김에게로 보내어 유다를 쳐서 멸하게 하시니라....(열왕기하 24:1-2)

여 호야김이 통치하기 시작할 때에 나이가 이십 오 세더라. 그가 예루살렘에서 십일 년 동안 통치하며 주 자기 하나님 눈앞에서 악한 것을 행하였더라. 바빌론 왕 느브갓네살이 올라와서 그를 치고 족쇄로 결박하여 바빌론으로 잡아가고 느브갓네살이 또  주의 집의 기구들을 바빌론으로 가져다가 바빌론에 있는 자기 신의 전에 두었더라.  보라, 여호야김의 남은 행적과 그가 행한 가증한 일들과 그에게 있던 것이 이스라엘과 유다의 열왕기에 기록되어 있느니라. 그의 아들 여호야긴이 그를 대신하여 통치하니라 (역대기하 36:5-8).

 

시드기아에 대한 심판 

열왕기하 24장과 역대기상 36장은 시드기야의 11년 간의 왕국 통치기간 동안 심판이 내렸음을 말해 주고 있다. 또한 열왕기하 25장 2절에서, 예루살렘은 심판이 내리기 전 시드기야  왕 11년까지 포위되어 있었음을 주목하라. 

시 드기야가 통치하기 시작할 때에 나이가 이십 일 세더라. 그가 예루살렘에서 십일 년 동안 통치하니라.......시드기야가 여호야김이 행한 모든 것에 따라 주의 눈앞에서 악한 것을 행하였으니 이는 주께서 예루살렘과 유다에 대하여 진노하사 그들을 자신의 눈앞에서 쫓아내실 때가 이르렀음이라. 이 때에 시드기야가 바빌론 왕을 배반하니라 (열왕기하 24:18-20)

시 드기야의 통치 제구년 시월 곧 그 달 십일에 바빌론 왕 느부갓네살이 자기의 모든 군대를 거느리고 예루살렘을 치러 올라와서 예루살렘을 향하여 진을 치고 사방으로 요새를 쌓으매 예루살렘이 시드기야 왕 제 십일 년까지 포위되었더니 사월 구일에 도시에 기근이 심하여 그 땅에 거하는 백성이 없었더라 (열왕기하25:1-3)

시 드기야가 통치하기 시작할 때에 나이가 이십일 세더라. 그가 예루살렘에서 석 달 열흘 동안 통치하며 주의 눈앞에서 악한 것을 행하였더라. 주 자기 하나님의 눈앞에서 악한 것을 행하고 대언자 예레미야가 주의 입에서 나온 말씀을 전하여도 그 앞에서 자기를 낮추지 아니하였으며 또 느브갓네살 왕이 그로 하여금 하나님을 두고 맹세하게 하였으나 그가 느부갓네살을 배반하고 목을 뻣뻣하게 하며 마음을 완악하게 하여 주 이스라엘의 하나님께로 돌아오지 아니하였더라. 또 제사장의 모든 우두머리들과 백성들도 이교도들의 모든 가증한 일을 본받아 크게 범죄하고 주께서 예루살렘에 두어 거룩하게 하신 그분의 집을 더럽게 하였더라. 주 그들의 조상들의 하나님께서 자신의 백성과 자신의 거하는 곳을 불쌍히 여기사 자신의 사자(使者)들을 통하여 백성들에게 말씀을 보내고 늦기 전에 일어나 보내셨으나 그들이 하나님의 사자들을 조롱하고 그분의 말씀들을 멸시하며 그분의 대언자들을 학대하여 마침내 주께서 자신의 백성을 향해 진노하사 구제할 방법이 없게 되었으니 (역대기하 36:11-16)

시 드기아가 바로 마지막 기회, 즉 열 한시였음을 주목할 만한 가치가 있다. 시드기야는 마지막 왕이었다. 시드기야 이후, B. C. 606년에 느브갓네살이 와서 이스라엘을 멸망시켰다. 그리고 이스라엘이라는 나라는 1948년까지 존재하지 않았다! 

시드기야는 11년을, 즉 열 한시의 - 주님의 진노로부터.... 구제할 방책이 전혀 없는.... 심판이 있기 전의 마지막 기회의 - 상황에 있었다.

11이라는 숫자는 심판을 뜻하는 하나님의 숫자라는 것에 어떤 의심이 있는가? 

아마도 어떤 사람은 그 모든 것들은 단지 우연의 일치라고 생각할 지도 모르겠다.  
하나님의 말씀에는 단지 우연의 일치라는 것은 없다. 

모든 하나 하나의 단어(every single word), 모든 하나 하나의 숫자(every single number)조차도 정확하게 주님께서 명하신 것이다.   

모든 단어 하나, 모든 숫자 하나에도 어떤 목적이 있는 걸까?  하나님의 말씀에는 우연의 일치라는 것은 없다.

예수님께서 그에게 대답하여 이르시되, 기록된바, 사람이 빵으로만 살 것이 아니요, 오직 하나님의 모든 말씀으로 살 것이라, 하였느니라, 하시더라 (눅4:4)

주 예수 그리스도에 따르면, 하나님 말씀의 영감은 심지어 가장 작은 "일점(一點), 일획(一劃)"에까지 적용된다.  

진실로 내가 너희에게 이르노니, 하늘과 땅이 없어지기 전에는 율법의 일점 일획도  결코 없어지지 아니하고 다 성취되리라 (마5:18)

" 점(jot)"은 희랍어나 히브리어에서 가장 작은 글자이다. "획(tittle)"은 액센트나 발음의 구분 점이다. "획"은 영어 알파벳 " i "의 위에 있는 점(dot)과 비슷할 것이다. 즉, 점이나 획은 글자를 쓸 때의 가장 작은 한 획인 것이다. 만일 하나님 말씀의 영감이나, 보존, 성취들이 점 하나, 획 하나 까지도 포함한다면, 그렇다면 하나님 말씀의 숫자들 또한 말할 필요도 없이 영감을 받았을 것이다. 

세상의 체계조차도, 알게 모르게 "11"이라는 숫자를 심판(판단)과 연관시킨다.  

20세기의 표현과 우화에 관한 Brewer의 사전은, "eleven plus(중등 교육 진학 선발 시험)" 에 대해 정의를 내리는 가운데 다음과 같이 적고 있다. 

eleven plus  학교에 다니고 있는 11세나 그 나이를 약간 상회하는 학생들에게 공식적으로 마련된 대단히 곤욕을 치르는 선발 시험의 이름으로. 다양한 형태의 중등 교육에 대한 학생의 적합성을 판단(judging)하는 수단으로서 영국의 잉글랜드와 웨일즈 지역에서 시행되고 있음...(Brewer's Dictionary of Twentieth-Century Phrase and Fable, P. 175)

어떤 사람들은 아마도 이렇게 생각할 지도 모르겠다.
어떤 숫자라도 이리 저리 엮어 낼 수 있어요! 

한번 해 보라... 

성경에서 어떤 다른 숫자가 그렇게 분명하게 심판과, 특히 중한 심판과 관련되는지를 나에게 보여 주라!
해 보라. 기다릴 테니... 

 

두로(Tyrus)에 대한 심판 

제 십 일년 그 달 일일에 주의 말씀이 내게 임하니라. 이르시되 사람의 아들아, 두로가 예루 살렘을 치며 말하기를, 아하, 만백성의 문이던 그녀가 부서져서 내게로  돌아왔도다. 이제 그녀가 피폐하게 되었은즉 내가 충만하게 되리로다, 하였도다. 그러므로 주 하나님이 이같이 말하노라. 보라, 오 두로야, 내가 너를 대적하노라. 바다가 그 파도를 일으키는 것같이 내가 많은 민족들로 하여금 올라와서 너를 치게 하리니 그들이 두로의 성벽을 무너뜨리며 그 망대를 헐 것이요, 나도 두로에서 그 티끌을 벗겨 내어 바위의 꼭대기 같이 되게 하리라 (에스겔서 26:1-4)

 

이집트의 왕 파라오에 대한 심판

제 십 일년 일월 곧 그 달 칠일에 주의 말씀이 내게 임하니라. 이르시되, 사람의 아들아, 내가 이집트 왕 파라오의 팔을 꺾었나니, 보라, 사람들이 그것을 싸매어 치료하지도 못하며 붕대를 대어 묶지도 못하고 칼을 잡을 만큼 강하게 하지도 못하리라. 그러므로 주 하나님이 이같이 말하노라. 보라 내가 이집트 왕 파라오를 대적하노라. 내가 그의 두 팔 곧 강한 팔과 꺾인 팔을 꺾어서 칼이 그의 손에서 떨어지게 하겠고  이집트 사람들을 민족들 가운데로 흩으며 여러 나라로 흩어 버리리라 (에스겔서  30:20-23).

 

열 한 명의 사도들 

갈보리의 심판이 주 예수 그리스도께 내려졌다. 그때 11명의 제자들이 있었다. 

갈보리의 십자가 위에서 무죄한 주 예수 그리스도께서 우리의 죄에 대해 대신하여 심판을 받으셨다. 그분은 한 사람의 저주받은 자로 죽으셨다. 죄에 대한 하나님의 심판을 만족시키셨다(이사야 53:11). 

그리스도께서 우리를 위하여 저주가 되사 율법의 저주에서 우리를 대속(代贖)하셨으니 이는 기록된바, 나무에 달린 자는 다 저주받은 자라, 하였음이라 (갈라디아서 3:13)

비록 주 예수께서 3년 동안을 공개적으로 가르치시고 선포 하셨음에도 붙잡히시지 않고, 유다의 배신으로 인해, 제자들의 수가 11명이 되어서야 비로소, 하나님의 심판이 시행 됐다. 

유다가 배신했던 밤, 그 날 밤 예수님은 심판장으로(흠정역에서는 법정으로 번역됨-역자주) 끌려 가셨다. 

그 때에 그들이 예수님을 가야바에게서 데려다가 법정(hall of judgment)으로 끌고 가니 이른 아침이더라. 그들이 자기 자신을 더럽히지 아니하고 유월절 어린양을 먹고자 하여 법정에 들어가지 아니하더라. 그러므로 빌라도가 그들에게 나가서 이르되, 너희가 무슨 일로 이 사람을 고소하느냐? 하매 그들이 그에게 대답하여 이르 되, 이 사람이 범죄자가 아니었더라면 우리가 당신에게 넘겨주지 아니하였으리이다. 이에 빌라도가 그들에게 이르되, 너희가 그를 데려다가 너희 법대로 재판하라, 하니 그러므로 유대인들이 그에게 이르되, 우리가 사람을 사형시키는 것은 법에 어긋나는 일이니이다, 하니라 (요한복음18:28-31)

사 도행전 1장에서, 사도행전 2장의 성령님께서 오시기 직전, 왜 사도들이 유다를 대신 할 한 사도를 선택했는지 그 이유가 궁금하지 않는가? 한가지 이유는 그들에게는 12명이 사도가 필요했다. 그들은 이스라엘의 각 지파에 하나씩 할당되는, 12개의 보좌에 오르기로 약속되어 있었기 때문이었다(마19:28). 하지만 심판은 이제 이루어졌으므로, 심판을 의미하는 11이라는 숫자의 열 한명의 명의 사도들은 12명이 되어야 한다는 것도 또 한가지 이유로 가능하지 않겠는가?  

 

성경 - 인간에 대한 하나님의 심판  

성경은 66권(6 ×11)으로 되어 있다. 6은 사람의 수다. 11은 심판의 수다. 성경은 인간에 대한 하나님의 심판이다.  

그 것이 바로 성경이 이 땅에서 가장 미움을 받는 책이 된 이유다. 그 때문에 성경은 전 역사를 통해 불태워지고, 비난을 받고, 비웃음을 당하고, 금지되고, 공격을 받았다. 그 때문에 사람들은 간단한 십계명조차도 입 밖에 내지 못하도록 입을 봉했다. 성경이 그들을 심판하기 때문이다. 

히브리서 4장 12절에서, 성경은 "마음의 생각과 의도를 분별하시는 분"이라고 말한다. 분별하는 사람은 재판관이다. 

이는 하나님의 말씀이 살아 있고 권능이 있어 양날 달린 어떤 검 보다도 예리하여 혼과 영과 및 관절과 골수를 찔러 나누기까지 하며 또 마음의 생각과 의도를 분별하시는 분이시기 때문이니 (히브리서4:12)

성경 전체를 통해서, 하나님의 말씀은 "심판"으로서 언급되고 있다.  

이에 모세가 와서 주의 모든 말씀과 그 모든 심판들을(judgments : 흠정역에서는  법도로 번역함-역자주) 백성에게 고하매 온 백성이 한 목소리로 응답하여 이르되, 주께서 하신 모든 말씀을 우리가 행하리이다, 하더라(출애굽기24:3)

요한복음 12:47-48에서, 예수 그리스도께서는 성경이 마지막 날에 우리를 심판(judge)하리라고 말씀하셨다. 

사 람이 내 말을 듣고 믿지 아니할 지라도 내가 그를 심판하지 아니하노라. 이는 내가 세상을 심판하러 온 것이 아니요, 세상을 구원하러 왔음이라. 나를 거절하고 내 말을 받아들이지 아니하는 자는 심판하는 이가 있으니 곧 내가 한 그 말, 바로 그 말이 마지막 날에 그를 심판하리라 (요한복음12:47-48)

하나님의 66권(6 ×11)의 책들은 인류(6)에 대한 심판(11)이다. 사실, 당신이 구원을 받지 못한다면, 그때는 하나님의 심판을 받을 것이다.  

우 리가 아직 죄인이었을 때에 그리스도께서 우리를 위하여 죽으심으로 하나님께서 우리를 향한 자신의 사랑을 당당히 제시하시느니라. 그러면 이제 우리가 그분의 피로 말미암아 의롭게 되었은즉 더욱더 그분을 통하여 진노로부터 구원을 받으리니 (로마서 5:8-9) 

하나님 말씀 즉 11과 심판에 대한 또 다른 흥미 있는 언급으로 시편 119편이 있다. 

시 편 119편의 주제는( 성경에서 가장 긴 장이다.) 하나님의 말씀이다. 흥미 있는 것은 심판이라는 단어가 시편 119편에서 22번 나온다는 것이다. 22는 2 ×11이다. 성경에서 숫자 2가 갖고 있는 의미 중에 하나는 증인(witness)이다. 또한 신기한 것은 시편 119는 1+1+9=11이라는 것이다. 

마태복음 18:16은 " ....두세 증인의 입으로 말마다 확증하게 하라." 라고 말씀하신다. 

두 강도가 주 예수 그리스도의 십자가에 달리심의 증인이 되었다(막15:27).
두 천사가 주 예수 그리스도의 부활의 증인이 되었다(눅24:4).
두 천사가 주 예수 그리스도의 승천의 증인이 되었다(행1:10-11).  

요 한계시록이 22장, 즉 2(증인) ×11(심판)이라는 것이 흥미롭다. 계시록은 주 예수 그리스도를 증거(계1:2: 증거 하는 사람은 증인이다.)하며, 하나님의 심판(계6:17, 11:18, 14:10, 14:19, 15:1, 16:1)의 신실한 증인(계1:5)이다. 

요한계시록 11장에서 무엇이 나오는지 아는가? 두 증인이다.(따라서 2*11=22이다!) 

내가 나의 두 증인에게 권능을 주리니 그들이 굵은 베옷을 입고 천이백육십 일을  대언하리라 (요한계시록11:3) 

예수 그리스도께서 사도들을 증인으로 파송하실 때, 둘 씩 둘 씩(two and two)보내셨다.

예수님께서 열두 제자를 부르사 둘씩 둘씩 보내기 시작하시며 부정한 영들을 제압하는 권능을 주시고 (마가복음6:7)

오 늘날조차도, 내가 보아온 모든 증인 프로그램이나 과정은 둘씩 짝을 지어 증인들을 파송한다. (여호와 증인이나 몰몬 교인들을 보라.) 또한 성경의 모든 중요한 사건들에서, 하나님은 적어도 2명의 증인을 세우셨다. 모세가 십계명을 받기 위하여 시내산으로 들어갈 때 왜 여호수아를 데리고 갔을까? 

하나님의 말씀은 하나님의 의로우신 심판(11)의 증인(2)이다.  

시편 119편에는 심판(judgment)이 22(2 ×11)번 나온다.

  1. 내가 주의 의로운 판단(judgment)들을 배울 때에는 올바른 마음으로 주를 찬양 하리이다 (시편119:7)
  2. 내가 주의 입의 모든 판단(judgment)들을 내 입술로 밝히 드러내었으며 (시편 119:13)
  3. 내 혼이 언제나 주의 판단(judgment)들을 사모하므로 상하나이다 (시편11:20)
  4. 내가 진리의 길을 택하고 주의 판단(judgment)들을 내 앞에 두었나이다 (시편119:30)
  5. 주의 판단(judgment)들은 선하시오니 내가 두려워하는 곧 나에 대한 모욕이 나를 떠나게 하소서 (시편119:39)
  6. 내가 주의 판단(judgment)들에 소망을 두었사오니 진리의 말씀을 내 입에서 아주 빼내지 마소서 (시편119:43)
  7. 오 주여, 내가 옛적에 주께서 행하신 판단(judgment)들을  기억하고 내 자신을 위로하였나이다 (시편119:52)
  8. 내가 주의 의로운 판단(judgment)들로 인하여 밤중에 일어나 주께 감사하리이다 (시편119:62)
  9. 내가 주의 명령들을 믿었사오니 선한 판단(judgment)과 지식을 내게 가르치소서  (시편119:66)
  10. 오 주여, 내가 알거니와 주의 판단(judgment)들은 바르오며 또 주께서 신실하신 가운데 나를 괴롭게 하셨나이다 (시편119:75)
  11. 주의 종의 날들이 얼마나 되나이까? 나를 핍박하는 자들에게 주께서 어느 때에 심판(judgment)을 집행하시리이까? (시편119:84)
  12. 주께서 나를 가르치셨으므로 내가 주의 판단(judgment)들에서 떠나지 아니하였나이다 (시편 119:102)
  13. 내가 주의 의로운 판단(judgment)들을 지키리라 맹세하였사오니 그것을 이행하리이다 (시편 119:106)
  14. 오 주여, 주께 간청하오니 내 입이 드리는 자원헌물들을 받으시고 주의 판단 (judgment)들을 내게 가르치소서 (시편119:108)
  15. 주를 두려워하므로 내 육체가 떨며 내가 주의 심판(judgment)들을 무서워하나이다 (시편119:120)
  16. 내가 공의(judgment)와 정의를 행하였사오니 나를 학대하는 자들에게 나를 버려두지 마옵소서 (시편119:121)
  17. 오 주여, 주는 의로우시고 주의 판단(judgment)들은 곧바르며(시편119:137)
  18. 주의 인자하심에 따라 내 음성을 들으소서. 오 주여, 주의 판단(judgment)에 따라 나를 살리소서
    (시편119:149)

  19. 오 주여, 주의 긍휼이 크오니 주의 판단(judgment)들에 따라 나를 살리소서 (시편119:156)
  20. 주의 말씀은 처음부터 진실하시오니 주의 의로우신 모든 판단(judgment)은 영원히 지속되리이다
    (시편119:160)

  21. 주의 의로운 판단(judgment)들로 인하여 내가 하루에 일곱 번씩 주를 찬양하나이다 (시편119:164)
  22. 내 혼을 살게 하소서. 그리하시면 내 혼이 주를 찬양하리이다. 주의 판단(judgment)들이 나를 돕게 하소서
    (시편119:175)

 

만일 당신이 성경을 주의해서 읽는다면, 시편 119편이 히브리어 알파벳 22글자에 맞춰 22개로 구분되어 있다는 것을 알 것이다. 시편 119편은 성경에서 그렇게 구분되어 있는 유일한 장이다. 흥미 있지 않은가?

 

예수 그리스도에 대한 심판

예수 그리스도께서는 갈보리에서 돌아가셨을 때 33세(3*11) 이셨다.
성경에서 3이란 수는 명백하게 신격 즉 하나님과 관계가 있다. 예수 그리스도께서는 육체를 입으신 하나님이셨다(딤전3:16). 예수께서 갈보리에서 돌아가셨을 때, 하나님(3)께서는 우리가 받을 심판(11)을 가져 가셨다. 

 아브라함이 이르되, 내 아들아, 번제 헌물의 어린양은 하나님께서 자신을 위하여  예비하시리라, 하고 그 두 사람이 함께 가서 (창세기22:8)

그러므로 너희 자신과 모든 양떼에게 주의를 기울이라. 성령님께서 너희를 그들의 감독자로 삼으사 하나님께서 자신의 피로 사신 하나님의 교회를 먹이게 하셨나니  (사도행전20:28)

 

대 백보좌 심판

요한이 계시록 20장에서 대 백보좌 심판을 보고 있었을 때, 요한은 11가지 일들을 보았다. 그러나 그것이 아주 우연하게도 11절에서 시작한다.

또 내가 크고 (1)흰 왕좌와 (2)그 위에 앉으신 분을 보니 땅과 하늘이 그분의 얼굴을 피하여 물러가고 그 자라마저 보이지 아니하더라. 또 내가 보니 (3)죽은 자들이 작은 자나 큰 자나 할 것 없이 하나님 앞에 서 있는데 (4)책들이 펴져 있고 (5)또 다른 책이 펴져 있으니 곧 생명 책이라. (6)죽은 자들이 자기 행위들에 따라 책들에 기록된 것들로 인하여 심판을 받으니 (7)바다가 자기 속에 있는 죽은 자들을 내어 주고 (8)또 사망과 지옥도 자기 속에 있는 죽은 자들을 넘겨주매 (9)그들이 각각 자기 행위들에 따라 심판을 받고 (10)사망과 지옥도 불못에 던져지니 이것은 둘째 사망이라.(11)누구든지 생명 책에 기록되지 못한 자는 불못에 던져지더라
(요한계시록 20:11-15)

성경에서 숫자 11은 심판이나 급박함과 연관이 있다는 것은 의심의 여지가 없다.  


그리고 넘버 세븐  

숫자 11과 7의 상호 관련성은 성경이나 세상 속에서 찾아 볼 수 있다. 

E. W. Bullinger는 자신의 책 Number in Scripture에서 7과 11의 조합에 많은 페이지를 할애하고 있다. Bulinger는 다음과 같이 적고 있다.




 " 이들 두 수 7과 11이 특별히 선택되었다는 것에 주목하는 것만으로도 지금 우리의 연구의 목적에 충분하다. 그 두 수 사이에 놀라운 관련성이 존재한다는 것은 예정에 의한 것이 틀림없다. 왜 7과 11이라는 두 수 이어야하는가? 다른 두 개의 수는 왜 안 되는가? 왜 두 수이어야 하고 세 수는 안 되는가? 우리는 그 이유를 설명 할 수도, 할 수 없을 수도 있겠으나, 그러나 우리는 그 사실을 외면할 수 없다."
(E. W. Bullinger, 
Number in Scripture, P.25)   

Bullinger는 숫자 7과 11의 믿기 지 않는 관련성을 몇 가지 열거하고 있다. 예를 들어...

음악에서: 7개의 기본음과 11의 반음

기하학에서: 피라미드(기반이 정사각형이다.)의 높이와 기반의 길이의 비(比)는 7:11이다. 7:11은 원의 지름과 반원주, 반원과 그것의 현과의 비율을 나타낸다.

(Bulliner는 자신의 책 20-27 페이지에서 과학과, 수학 등과 관련된 7과 11의 현상에 대하여 보다 많은 상세한 정보를 준다.) 

7과 11의 조합은 흥미롭게도 세상 속에서도 볼 수 있다. 예를 들어 유명한 주사위 던지기 놀이의 seven come eleven이라든가, 유명한 체인 형태의 편의점인 seven eleven등이다.  

7 과 11은 운(rhyme)이 맞는 유일한 두 수라는 것도 흥미롭다. 7=3+4 이며 11=5+6 이다. 따라서 3,4,5,6이 완벽한 등차 급수를 이루며, 3 ×4 ×5 ×6=360 이 나온다. 우리의 세상은 360개의 요소들로 나뉘어 진다. 예를 들어, 성경의 1년은 360일이며, 원은 360도이다. 위도와 경도는 360도이며, 황도대(Zodiac)에서 사용되는 천궁도(circle of heaven)는 360개의 부분으로 나뉘어 진다.  

성경에서 7의 숫자는 어떠한가? 

성경에서 그 의미가 가장 분명한 숫자는 7이다. 7은 성취(완성)의 수이다. 이것은 성경의 도처에서 발견된다.  

피터 럭크만은 자신의 책인 Bible Numerics에서 다음과 같이 적고 있다.




"이제는 숫자 7의 차례다. 많이 생각하고, 연구하고, 공부하고, 숙고할 필요조차 없다. 7이란 수는 아주 명백하게 성취(완성)를을 뜻하는 수이므로 어떤 정당화도 필요로 하지 않는다.(Peter S. Ruckman, Bible Numerics, P.23)"

숫자 7과 완성에 대한 예를 성경에서 찾아보자. 

창조: 이것은 7이라는 수가 처음 나오는 예다. 

일곱째 날에 하나님께서 자신이 만든 일을 마치시고 자신이 만든 모든 일을 떠나 일 곱째 날에 안식하시니라(창세기2:2) 

마지막 책인 요한계시록을 보자. 

성경의 마지막 책인 요한계시록은 7이란 수로 가득하다.(요한계시록에서만 59번이 나온다.) 

일곱 교회(계1:4)
일곱 영(계1:4)
일곱 등잔대(계1:12)
일곱 별(계1:16)
일곱 등불(계4:5)
일곱 하나님의 영(계:4:5)
일곱 인(계5:1)
일곱 뿔(계5:6)
일곱 눈(계5:6)
일곱 천사(계8:2)
일곱 나팔(계8:2)
일곱 천둥(계10:3)
일곱 머리(계12:3)
일곱 왕관(계12:3)
일곱 재앙(계15:1)
일곱 금 대접(계15:7)
일곱 산(계17:9)
일곱 왕(계17:10)


계시록에는 왜 이렇게 많은 일곱(7)이 있는 걸까?
계시록에서 하나님의 계획이 성취되기 때문일까?
계시록은 7이란 수로 성취된다.
7과 성취의 다른 예이다.(더욱 더 많은 예를 들 수 있다.) 

일곱째 천사가 음성을 내는 날들 곧 그 천사가 나팔을 불기 시작할 때에 하나님께서 자신의 종  대언자들에게 밝히 드러내신 것같이 하나님의 신비가 이루어지리라, 하더라 (요한계시록 10:7) 

일곱째 천사가 자기 대접을 공중에 쏟아 부으매 큰 음성이 하늘의 성전에서 왕좌로부터 나서 이르시되, 다 이루어졌도다, 하시니 (요한계시록 16:17) 

만일 7이 성취의 숫자라면, 그리고 11이 심판의 숫자라면, 성경에서 7과 11은 어떤 연관성이 있을까? 

노아의 홍수의 심판이 창세기 7장 11절에서 일어난 것을 알고 있는가?
그렇다면 바벨탑의 심판은 창세기 11장 7절에 있을까?
 

한번 찾아 보라! 

또한 세계 무역 센타 폭파 사건에서도 숫자 7이 특이하게 나타난다.
그리고 의미심장하게 숫자 11과 연관되어 있다. 

공격 날짜 9/11 : 9+1+1=11, 하지만 9-1-1=7이다.
9월 11일은 1년 중 254일째 되는 날이다 : 5+4+2=11, 그러나 5+4-2=7이다.
뉴욕시(New York City)는 11개 글자다. 하지만 뉴욕(New York)은 7개 글자다.
11편 기는 92명의 승객이 타고 있었다 : 9+2=11 그러나 9-2=7이다.
두 번째 여객기는 77편 기였다. 77=7 ×11이다.

9월은 라틴어 명칭으로는 7이다. 이러한 숫자 11과의 연관성과 더불어, 이러한 것들은 하나님께서 미국에 대한 심판으로서 무역 센타의 폭발을 허락하셨다는 것을 의미하는 걸까?   

7과 11의 조합은 미국에 대한 하나님의 계획의 성취며, 완성이자 심판을 향해 가고 있다는 것을 의미하는 것일까?  

역 사상 가장 엄청나고 곳곳에 설치되어 있는 감시 기술로도 어떻게 세계 무역 센타 폭파에 대하여 감도 잡을 수 없었는지 궁금하지 않는가? 전화나, 컴퓨터, 이메일 등과 같은 모든 형태의 전자 통신을 포착할 수 있는 NSA의 Echelon과 같은 그처럼 정교한 첩보 기술을 갖고서도 어떻게 그것을 놓칠 수 있었는가? 테니스 공조차도 찾아 낼 수 있는 첩보 위성을 즉  빈 라덴(Bin Laden)을 감시하는 눈을 가지고 있으면서도 어떻게 벌어지고 있는 일들에 대해 속수 무책일수가 있었단 말인가? 세계적인 테러리즘 감시 기술을 가지고 있는 이스라엘과 같은 나라들이 어떻게 그것을 모르고 있었단 말인가? 무역 센타 폭파는 일년 이상을 준비 했고, 수 백 명의 사람, 여러 국가들이 연계되어 있었고, 엄청난 자금, 여권 위조, 비행 조종사 자격증, 수십 차례의 사람들의 위험 경고 등이 있었지만, 그러나 거듭 거듭 모든 사람들이 그것을 낌새도 알아차리지 못했다. 어떻게 그럴 수가 있단 말인가? 도대체 어떻게 우리의 모든 최첨단 감시 기술이 이처럼 엄청나고, 세밀하게 계획된 이 일을 놓칠 수가 있는 지를 조사하기 위한 의회가 즉각 소집되었다. 이 모든 테러가 진행되고 있는 동안 10,000에서 20,000명의 감시 첩보 요원들은 마치 눈뜬장님이나 마찬가지였다. 미국의 모든 그리스도인들이 물었다. " 하나님께서 미국을 더 이상 돌보시지 않는가?"

미국은 심판을 향해 가고 있는가? 

어쩌면.... 

설마.... 

솔직히 말해 아무도 모른다. 하나님 외에는! 

이것은 위대한 미국의 종말의 시작일 수도 있다. 아니면 미국 역사에서 가장 위대한 시대가 바로 가까이에 와 있는 것 일 수도 있다.   

누구도 확실히 알지 못한다. 하지만 분명한 한가지는 - 우리 모두는 하나님의 심판 앞에 서게 되리라는 것이다.  

틀림없다. 어느 날, 당신은 하나님 앞에 서게 될 것이다.
언젠가는 당신은 죽을 것이고, 그리고 당신은 하나님의 심판 앞에 서게 될 것이다.

히브리서 9장 27절은 매우 분명하다. 

 한 번 죽는 것은 사람에게 정하신 것이요, 그 뒤에는 심판이 있으리니 

그러니 친구여, 심판으로부터 당신을 구할 수 있는 방법이 딱 한가지가 있다.. 

단지 한가지! 

주 예수 그리스도! 

예수께서 그에게 이르시되, 내가 곧 길이요, 진리요, 생명이니 나로 말미암지 않고는 아버지께로 올 자가 없느니라 (요한복음14:6)

죽음은 분명하다..... 언젠가는 당신은 죽는다...... 

TV에서 보았던 기억이 난다. 세계 무역 센타가 폭파될 때 사망한 한 남자의 아내가 흐느끼며 말하고 있었다.  

" 다른 날과 마찬가지로 막 집을 나섰죠. 그는 출근 준비를 마치고, 내게 키스를 하고 집을 나섰어요. 그리고 두 세시간 뒤....그는 죽었어요. 누구도 몰랐어요." 

당신이 세계 무역 센터에 있었다면....
바로 이 순간 - 당신은 아마도 천국에 있을 것이다. 아니면 지옥에..

그 날이 내일 일 수도, 어쩌면 다음 주 일 수도, 5년 뒤, 10년, 20년, 50년 뒤 일 수도 있다. 

 너는 내일을 자랑하지 말라. 이는 하루 동안에 무슨 일이 일어날지 네가 알지 못하기 때문이니라
(잠언 27:1). 

한가지 분명한 것은 - 죽음이 오고 있다는 것이다. 

친구여, 나는 가장 중요한 질문을 하고자 하네. 

주 예수 그리스도를 당신의 구세주로 영접했는가? 예수 그리스도께서 갈보리 십자가 위에서 당신의 죄의 값을 치르셨음을 믿는가? 

솔직히 이 글을 쓴 진짜 이유는 세계 무역 센타가 아니라 우리의 삶이 얼마나 깨지기 쉬우며, 불확실한가를 말하려는 것이다. 이 글의 진짜 이유는 당신이 불못 속에서 영원을 보내지 않게 하려는 것이다. 

 

         누구든지 생명 책에 기록되지 못한 자는 불못에 던져 지더라  (요한계시록20:15) 

내가 처음 세계 무역 센타 폭파의 비극적인 소식을  들었을 때, 내게 제일 먼저 떠오른 생각은 죽음을 의심하지 않았던 사람들 가운데 얼마나 많은 사람들이 하나님을 만날 준비를 했을까하는 것이다.   

당신은 하나님을 만날 준비가 되어 있는가?  

세계 무역 센타가 우리에게  분명하게 보여준 한가지는 죽음은 의심하지 않는 순간에 -하나님을 만날 준비를 할 마지막 기회도 주지 않고 찾아온다는 것이다. 

  한 번 죽는 것은 사람에게 정하신 것이요, 그 뒤에는 심판이 있으리니 (히브리서  9:27)

친구여, 만일 그대가 주 예수 그리스도를 지금까지 결코 믿은 적이 없다면, 지금 구원을 받을 수 있다네.

당신은 지금 당장 구원을 받을 수 있다! 

구원을 받는 것은 간단하다. 

 

● 당신은 죄인임을 알라. 

이것은 기록된바, 의로운 사람은 없나니 단 한사람도 없으며 (로마서 3:10)
모든 사람이 범죄하여 하나님의 영광에 이르지 못하더니 (로마서 3:23) 

 

● 예수 그리스도께서 당신의 죄 값을 치르기 위하여 십자가에서 돌아가셨음을 믿으라. 

친히 나무에 달려 자신의 몸으로 우리의 죄들을 지셨으니 (베드로 전서 2:24)
우리를 사랑하사 자신의 피로 우리의 죄들로부터 우리를 씻으시고 (요한 계시록 1:5)





댓글

이 블로그의 인기 게시물

The Pyramid of Giza's north latitude (29.9792458^) is the same from the speed of light (299,792,458m) to 9 decimal places 기자의 피라미드는 북위(29.9792458^)가 빛의 속도(299,792,458m)부터 소수점 9자리까지 동일하다 <꾸란 9장에는 왜 시작이 없는가?>

He makes his brain disappear to hide evidence, and instinctively hides between chairs to avoid bullets. However, Illuminati secret agent Jacqueline shoots Kennedy in the left brain to hide the evidence and finds and picks up the bullet casing. 증거를 숨기기 위해 뇌를 사라지게 만들고, 총알을 피하기 위해 본능적으로 의자 사이에 숨는다. 그러나 일루미나티 비밀요원 재클린은 증거를 숨기기 위해 케네디의 좌뇌에 총을 쏘고 총알 탄피를 찾아 줍는다.

Illuminati Samsung Zombie Parasite Lee Jae-myeong appointed to power through election fraud in exchange for destroying Korea Passing the Yellow Envelope Act right before meeting Trump, a dirty parasite in the United States, confirms to Trump that he is passing a bill that will destroy Korea. 일루미나티 삼성좀비기생충 이재명이 한국을 파괴하는 대가로 선거부정으로 집권한 이재명이 미국의 더러운 기생충인 트럼프를 만나기 직전 노란봉투법을 통과시켜 한국을 파괴하는 법안을 통과시키고 있음을 트럼프에게 확인시켜준다.